KEGG   Halanaerobium hydrogeniformans: Halsa_0462Help
Entry
Halsa_0462        CDS       T01349                                 

Definition
(GenBank) peptidase S8 and S53 subtilisin kexin sedolisin
  KO
K14645  serine protease [EC:3.4.21.-]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:has00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Halsa_0462
Enzymes [BR:has01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Halsa_0462
Peptidases [BR:has01002]
 Serine Peptidases
  Family S8: subtilisin family
   Halsa_0462
Chaperones and folding catalysts [BR:has03110]
 Intramolecular chaperones
  Subtilisin family
   Halsa_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 Big_4
Motif
Other DBs
NCBI-ProteinID: ADQ13935
UniProt: E4RPQ1
Position
533365..535224
Genome map
AA seq 619 aa AA seqDB search
MKLKSIHSKYILLFFLILAALLLISGCDRGSGSSSISETAVVVSSDIESVQSFYAPLGLS
AAEIIENYLPKKAEITLSDDSTQTVELHWEAPENYDSQTEGAYFFNGYYYLPDDSIKEIT
AEVILKEDIASVSGRLSFDFAFAYSTSAASFSTSTTSLNSDSLLSSNEEEYIIAFKSGTK
REEREKIIRSQGAELIKELPSLNAAVVKFPPFAVNAEMSLAADSSVSYIEPNYQVHILSY
EEPNDPRFAQQWNLDMIDLPYAWSSQKGKSNIRVAVIDTGIELEHEDLAARIDREYAYNF
ISQNSNVSDGHGHGTHVSGTIGALTDNSLGVAGVSWAGEILPLKALNDRGSGNVSDLAAA
ILYAAGLDDRAGNMEPVDIINLSLGTSSDSSTLRNAINDAAAEGVILVAAAGNNQGRINY
PAAYENVIAVGAADQTGELAYYSSYGPELDFIAPGGNDSNFGILSTYKNNSYQESSGTSM
AAPHISGLIALLLSDNNSASEVKEILEQASIHLGFEEESDKIGYGLVNANFALNRIDKIK
IIVGERSGDSIEAAAETEISIKGGDYFIGDIPIGEYSLFAWIDIRDNGLIEAGDYLLEIS
ELDFSQEINIEQDLRLVFD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaaatccattcattcaaaatacatattattattctttctcatcttagcagca
cttttattaatcagtggttgtgataggggttcaggttctagctccatttccgaaactgct
gttgttgtatcatctgatatagaatcagtacagagcttttatgctccactgggcttaagt
gctgcagagattattgaaaattatctacctaaaaaggcagagataactttaagtgatgac
agtactcaaactgttgaactgcactgggaggctcctgagaactatgatagtcagacagaa
ggagcctatttttttaatggttattattatttacccgatgatagtattaaagaaattact
gctgaggtgattttaaaagaagatattgcttctgtttcaggccgactgagctttgacttt
gcctttgcttattctacttcagctgctagctttagtacttctactacttctctcaatagt
gattcattgctcagcagcaatgaagaggagtatatcattgccttcaaatctggaactaag
cgtgaagaaagagaaaaaatcatcaggtctcaaggggcagaactaataaaagagctgcct
tcattaaatgctgcggtagtaaaattccctccttttgctgtgaatgcagagatgagtctc
gcagctgacagcagtgtaagctatattgagcctaactatcaggtacatattttaagttat
gaagaaccaaatgatccccggtttgctcagcagtggaatttagatatgatagatctgcct
tatgcctggtcatctcaaaagggcaagagcaatattagagtggctgtaatagataccgga
attgagcttgaacacgaggatttggctgccagaatagatagagaatatgcctataatttt
attagtcaaaattctaatgttagtgatggtcatggtcacggcacccatgttagtggtacc
attggggctttaacagataattctttaggtgttgccggggttagctgggcgggagagata
cttcctttaaaagcattaaatgacagaggttctggtaatgttagtgatcttgcagctgcc
attttatatgcggcaggacttgatgatagagctggcaatatggagccggttgatattatt
aatctttctctgggaactagtagtgactcaagtaccttaagaaatgcaattaatgatgct
gctgcagaaggtgttatcttggtagctgctgccgggaataatcagggtaggattaattat
ccagctgcttatgaaaatgtcattgctgtgggagcagcagatcaaactggggagttggca
tattattcaagttatggcccggaactggactttattgctccaggaggtaatgacagcaat
tttgggatattgagtacatataaaaataatagttatcaagaatcatcgggtacttcgatg
gcagctcctcatatttctggactgatagctctactgctatctgataataattcagcttct
gaagtcaaagagattttagaacaggccagtattcatctcggttttgaagaggagagcgat
aaaattggctatggtttggttaatgccaattttgcacttaataggattgataaaataaaa
attattgttggtgagcgcagtggagatagtattgaagctgcagcagaaaccgagatatcc
ataaagggtggagattattttattggtgatatacctataggtgagtattccctatttgcc
tggatagatatcagagataatggtctcattgaagcaggagattatctattggaaatatca
gaacttgatttcagccaggaaattaacattgagcaggatctaagactggtttttgattaa

DBGET integrated database retrieval system