KEGG   Halanaerobium hydrogeniformans: Halsa_0466Help
Entry
Halsa_0466        CDS       T01349                                 

Definition
(GenBank) hypothetical protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADQ13939
UniProt: E4RPQ5
Position
540682..541434
Genome map
AA seq 250 aa AA seqDB search
MAKEKSLKEKLEKKMLTKSDIPIIVLLTVLFSFFVIWRLRVYSPDLSLNLFSELIGVAFT
LFIIDTLLVRSKNKLWKLVHKDIDYLISRNVNRLRDGIATRVFKFEPDLDSQVSFNEKIE
ALSKERADFLAEMDELDKDELIIKIKENDFFNQENYDYFDEKAEDFWEILNMKYSEYLAP
ELVSELIELHTGLKDLCSAIRQHAKSDILKENKDYYRSLGVESAAQSLVVIIENLNQLKA
AGYSENAKVS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaagagtttaaaagagaaattagaaaagaaaatgttgactaagtctgac
ataccgattattgttctattaacagttctttttagtttttttgttatctggcggttgagg
gtatatagtcctgatctttctcttaatcttttttcagaactgattggtgttgctttcacc
ctctttattattgacactctgcttgtgagatctaaaaacaagctctggaagctggttcat
aaagatattgattatttaatcagtcggaatgttaacagattgagagatggaattgcaaca
cgagtctttaagtttgagccagatctagattctcaagtttcatttaatgaaaagatagaa
gctctcagcaaagaaagagcagactttttggctgaaatggatgagctggacaaagatgag
ctcattattaaaatcaaagaaaatgatttcttcaatcaagaaaattatgattattttgat
gagaaagcagaagacttttgggagatattaaatatgaagtattctgagtatttggcacct
gaattggtttcagagctgattgaacttcatactggacttaaagatctctgcagtgcaatt
agacagcatgctaaaagtgatatcctgaaggaaaacaaagactattatcgcagtcttggt
gtggaatctgcagcccaaagtttggttgttataattgaaaatttaaaccagctgaaagca
gccggctattcagaaaacgcaaaagtcagctaa

DBGET integrated database retrieval system