KEGG   Halanaerobium hydrogeniformans: Halsa_0469Help
Entry
Halsa_0469        CDS       T01349                                 

Definition
(GenBank) coenzyme PQQ synthesis protein B
  KO
K06136  pyrroloquinoline quinone biosynthesis protein B
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Halsa_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B DUF4216 Lactamase_B_6
Motif
Other DBs
NCBI-ProteinID: ADQ13942
UniProt: E4RPQ8
Position
543785..544672
Genome map
AA seq 295 aa AA seqDB search
MVDRALIKVLGTAQDAGHPQLNCQCSHCQAARTDASLKRLQSSLALIDKKEQKSFVFDAS
PAFSEQLDNLNELVRKKNYSVDHLSGILLSHAHLGHYLGLLYLGKEALNTSQLPVYLSQK
MFDFLKNNAPWSDLFKNGNIKAEVFEFEKEYNLTKEIRFKAVEIKHRNEYADTAAFIVNT
QEKAFFYLPDLDSWQGFERKFREILAEVDYVFLDGTFFDKKELGELRGRDLKEVPHPPII
ETIKLFSDLNKAERSKIYFTHFNHTNRILDLDANKFEYVKSKHFNLLEEGQEFNL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttggttgatagagctttaattaaagttttaggaactgcccaggatgctggtcatcctcag
cttaattgtcagtgttctcactgccaggctgcaaggactgatgcttcattaaaaaggctg
cagagttctctggccctaatcgataaaaaagagcagaaatcctttgtttttgatgcaagt
cctgctttttctgagcaattagataatttaaatgaacttgttcgtaaaaaaaattatagt
gttgatcacttaagcggaatcttacttagccatgcccacctaggtcactatctaggtcta
ctttatctaggaaaagaagcattaaacacctctcaattaccggtatatttaagccaaaaa
atgtttgatttcttaaagaataatgctccctggtcagacttatttaaaaatgggaatatc
aaagctgaagtttttgaatttgaaaaagaatataatttaacaaaagagattagatttaaa
gcagtagaaataaagcatagaaatgaatatgcagatacggcagcttttatagttaatact
caagaaaaagcttttttctatctgcctgatctcgatagctggcagggctttgagagaaaa
tttagagaaattcttgctgaagtagattatgtgtttttagatggtacttttttcgataaa
aaagagctgggtgaactgaggggaagagatttaaaagaagttcctcatcctccaataata
gagacgattaaattattttctgatttaaataaagctgagagatcaaaaatttattttacc
cactttaatcatactaatagaatactagatttagatgctaataagtttgaatatgttaaa
agcaagcattttaatttgctggaagaaggtcaggaattcaacctttaa

DBGET integrated database retrieval system