KEGG   Halanaerobium hydrogeniformans: Halsa_0475Help
Entry
Halsa_0475        CDS       T01349                                 

Definition
(GenBank) glycosyl transferase, WecB/TagA/CpsF family
  KO
K05946  N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [EC:2.4.1.187]
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:has01003]
    Halsa_0475
Enzymes [BR:has01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.187  N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase
     Halsa_0475
Glycosyltransferases [BR:has01003]
 Polysaccharide
  Bacterial polysaccharide
   Halsa_0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: ADQ13948
UniProt: E4RPR4
Position
552990..553724
Genome map
AA seq 244 aa AA seqDB search
MRDFLTILNVKIDKLDLDGATARIRSLLGDDNSSLVVTPNSEMIAMAAEDSELAEILNSA
ALATADGAGVVLASMIMGDKLPERVAGFDLINHLFSDLEQEDYNFYFLGSKPGIVDRAVV
NLKQKYKNLNIAGYHHGYLDKELQEEIIAEINAKEIDLLLVGMGVPLQERFLANNLAKLK
VKVAITVGGSFDVLAGEVNRAPLWMQKVGLEWFYRLIQEPSRFARMLALPKFIYLVTKKR
FLKN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgagagattttttaacaatattaaatgtaaagattgataagcttgatctggatggggca
acagcaagaattcgttctttgcttggtgatgacaattcctcacttgtggtaactcctaat
tctgagatgatagctatggctgcagaggattcggagcttgctgagatactaaattctgca
gcactggcaaccgcagatggagctggagtcgttctggcttcaatgataatgggagataaa
ttaccggaaagggtagcaggatttgatttgatcaatcaccttttttcagatttagagcag
gaagactataatttctattttttgggcagtaaaccagggatcgttgatagagcagtggta
aatctaaagcagaaatataaaaatttgaatattgccggttatcaccatggttatttagat
aaagagctgcaggaagaaataatagctgagataaatgcgaaggagatcgatcttctttta
gtaggaatgggagttccccttcaggaaagatttctggccaacaacctggctaagctcaag
gtcaaagttgccataactgtggggggaagttttgatgtactggcaggtgaagtaaatcgg
gctccactctggatgcaaaaagttggtcttgaatggttttacaggcttatccaggaacca
tcgcgttttgcaaggatgctggccctgccgaaatttatttatcttgttacaaaaaaacgc
tttttaaaaaactga

DBGET integrated database retrieval system