KEGG   Halanaerobium hydrogeniformans: Halsa_0477Help
Entry
Halsa_0477        CDS       T01349                                 

Definition
(GenBank) carboxyl-terminal protease
  KO
K03797  carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:has01002]
    Halsa_0477
Enzymes [BR:has01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     Halsa_0477
Peptidases [BR:has01002]
 Serine Peptidases
  Family S41: C-terminal processing peptidase family
   Halsa_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S41 PDZ_2 PDZ_6 PDZ Tricorn_PDZ DUF4621 MspA
Motif
Other DBs
NCBI-ProteinID: ADQ13950
UniProt: E4RPR6
Position
554697..555911
Genome map
AA seq 404 aa AA seqDB search
MISKIREIYQNKFIVFMLALFLMATILGGTLSAQEVELDEPVTEESLEESDYTKANAFQD
IMFLLQNYYVEDVELDTLIEGAIEGMLNKVDRYSYFMTPKEFEEMQEEYEGKYGGIGIVI
TTRDNELTIVSPINNTPGERAGLQSGDVIKEIDGQDTSEMSQMKAADLMRGEEGTDVILK
IKRGQEDPFEVELTREDIEVPYVESEMKTDQIGYISLAQFIENVGSDIEKELAELKEAGA
QGIILDLRNNPGGILSESIDVASVFLEEGDIVSVRQRDETERILEVNQEMNSDSEIPLIV
LINRGSASGSEIVAGAFQDYERATIMGTTSFGKGVVQSVIPLQDGSAVSLTTARYYTPKD
NYIHELGIEPDIKVEFDADAAAEEIDNQLEAAIEEMQRILAERE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgataagcaaaataagagaaatttatcagaataaatttattgtttttatgctggccctg
tttttaatggcaactatactgggtggaacactatcagcccaggaagtagagctggatgaa
cctgtaactgaagagtcactggaagaatcagattatactaaggcaaatgcttttcaggat
ataatgtttttgctgcagaactattatgtagaagatgtagagcttgatactttgatcgaa
ggtgctatcgaggggatgttaaataaggttgaccgttattcatattttatgacccccaaa
gaattcgaagaaatgcaggaggaatatgaaggtaaatatggtggaattggaatcgtaatt
acaactcgtgataatgagctgacaattgtttctccgatcaacaatactcctggagagagg
gcaggcctacagtctggtgatgtgattaaagagattgatggccaggatacttcagaaatg
tcacagatgaaggcagctgatttaatgaggggtgaagaaggtacagatgttattttgaag
attaaaagaggtcaggaagatcccttcgaagttgagctaacaagagaggatattgaagta
ccctatgtagaatctgaaatgaaaacagatcaaataggatatattagtctggcccagttc
atagaaaatgttggtagtgatatagaaaaagaattggccgaattaaaagaggctggtgct
cagggaataattcttgatctgcgcaataatccgggtggtattctttctgaatcaatagat
gtagcctctgtatttttagaagagggtgatattgtttctgtaagacagagagacgaaacc
gaaaggatacttgaagtaaatcaggaaatgaactctgactctgagattcctttgattgta
ttgatcaatagaggatctgcaagtggctcagaaatagttgctggagcttttcaggattac
gaaagagcaactattatggggacaaccagttttggtaagggagtagttcagtctgtaata
cctctgcaggatggttcagcagttagcttaacaactgccaggtattatactcctaaagat
aattatatccacgaattaggtatcgaacctgatattaaggttgagtttgatgctgatgct
gcagctgaagaaattgataatcagctggaagcagctattgaagaaatgcagagaatttta
gctgaaagagaataa

DBGET integrated database retrieval system