KEGG   Halanaerobium hydrogeniformans: Halsa_0480Help
Entry
Halsa_0480        CDS       T01349                                 

Definition
(GenBank) hypothetical protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRC
Motif
Other DBs
NCBI-ProteinID: ADQ13953
UniProt: E4RPR9
Position
557613..558389
Genome map
AA seq 258 aa AA seqDB search
MLRKLNDLKGFTVQGKKKELGKASDFYFDQDHFVLRYLVLETDGWLKQEQTLISTDEIEA
VDYNKKEIKTAMTAEELENGPSLEKNKPISKIMEEKVVKYYDWPLYWASSTPGGVPTIPA
GTKMREKLFDFETLTDEEKQEKEEELDSNLRSLNEISGYEIQAVDKSFAKVKDLFVDEED
WLIRYLLIDTRKILPAKKVIIAPEWIRHISWDRKQVFIKKSKKEIKNAPKYKEDDAEKLV
DREYEKDLYDYYDEPEYW
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggaaattaaatgaccttaaaggatttacggttcagggtaaaaagaaagaatta
ggtaaggccagtgatttttactttgatcaagatcattttgtgctccgctacttagttttg
gaaactgatggctggttgaaacaggaacagaccttgatttctaccgatgaaattgaagct
gttgattacaataaaaaagaaattaaaacagccatgacggcagaagaattagaaaatggc
cccagcctggagaaaaataagccgatttctaaaataatggaggaaaaggtagtaaaatat
tatgactggcccctttattgggcgagttctaccccgggtggagtacctactataccagct
ggtacaaaaatgagagaaaaattatttgattttgaaaccctgactgatgaagaaaaacag
gaaaaagaggaagaacttgattcgaatctcagaagtttaaatgagataagtggttatgaa
attcaggctgtcgataagagttttgctaaggttaaagacctatttgtcgatgaagaagat
tggctgatccgttatttattaattgatactcgtaaaatattgcctgccaaaaaagtaata
attgcccctgaatggattcgccatatcagctgggatagaaagcaggtttttattaagaaa
agtaaaaaagaaattaaaaatgcccctaaatacaaagaagatgatgctgaaaaactagtt
gatagagagtatgaaaaagatctttatgattattatgatgagcctgagtattggtga

DBGET integrated database retrieval system