KEGG   Halanaerobium hydrogeniformans: Halsa_0482Help
Entry
Halsa_0482        CDS       T01349                                 

Definition
(GenBank) excinuclease ABC, A subunit
  KO
K03701  excinuclease ABC subunit A
Organism
has  Halanaerobium hydrogeniformans
Pathway
has03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:has00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    Halsa_0482
DNA repair and recombination proteins [BR:has03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Halsa_0482
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      Halsa_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_16 AAA_29 RsgA_GTPase AAA_22 AAA_23 AAA_33 AAA_25 AAA_18 APS_kinase ATPase_2 cobW Viral_helicase1 RNA12 AAA_21 NB-ARC DnaJ_CXXCXGXG BCA_ABC_TP_C NTPase_1
Motif
Other DBs
NCBI-ProteinID: ADQ13955
UniProt: E4RPS1
Position
560746..563556
Genome map
AA seq 936 aa AA seqDB search
MAKDRIIVKGAEEHNLKKIDLEIPRDKLIVITGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMEKPRVEYIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLYARVGIP
HCPECGQEINSQTVDEIVDQVLELPERTKIMVMAPIVRGRKGEHERTFLQAVRDGFVRAR
IDGEIMLLEDAQKLDKNIKHDIEVIVDRLIVKSGIRERLADSVETALEYADGLVMINEVD
GETTTYSEKFACVDCGISLEEKSPRMFSFNSPYGACENCGGLGVKKEFDPELILDQDKSI
ADGGIIPWKNSSSRYYPALLEALAEKHDFSRQTPLKKLDEDLIKLLLYGSKEKITFPYTN
RYGRTRDHTTKFKGVIGYLQKRMSDSDSPGTHKRMERYMNEIPCQVCGGQRLKPEVLAVT
IGGLSIAEFTSFSIKDAYDFLEEVDFDERRAYIGKEILKEVKARLRFLLDVGLEYLTLDR
SAGTLSGGEAQRIRLATQIGSGLVGVLYILDEPSIGLHQRDNNRLINTLEHIRDQGNTVI
VVEHDEETIRSADHIIDIGPGAGKHGGEIVAEGNVDDIINEKRSLTGQYLNGSKKIEIPE
DRYQPNGNWLTIEGARQHNLKNIDVDIPLGTFTCVTGVSGSGKSTLVNNVLKRRLMQEIY
DSTLHPGDHDGIKGLEQVDKVINIDQSPIGRTPRSNPVTYTKVFNYIRDVFASTPEAKQR
GYEIGRFSFNVKGGRCEACKGQGEEQIEMHFLPDVYVPCEVCDGKRYNRETLEIKYKGKS
IADVLDMNVEEALEFFENIETIRRRLQTLYDVGLGYIRLGQPATTLSGGEAQRVKIAKEL
GKRSTGQTIYLLDEPTTGLHFDDVKKLLSVLHRLREDGNTVIVIEHNLDVIKSADYIIDL
GPEGGEKGGQLIAKGSPEDVANNESSYTGRFLKDIL
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagatcgaataatcgttaagggtgctgaggagcataaccttaaaaaaatagat
ttagaaattccgcgtgataaattaatagttataacaggcttaagtggttctggtaaatct
tcccttgcctttgatacaatttatgcagagggacagaggcgctatgttgaatcactatct
gcctatgcaaggcagtttttaggtcagatggaaaaacctcgggtggaatatatcgagggt
ctttctcctgcaatttctatcgaccagaaaaccaccagtcgtaatccccgttcaactgtg
ggaaccgttaccgagatttatgattatctgcgtctgctttatgctagagttgggattcct
cactgtcctgagtgtggtcaggagataaactctcaaactgttgatgaaattgtagatcag
gtcttagaacttccggaaagaacaaagattatggtaatggctccaattgtaagggggcgc
aagggtgaacacgagagaacctttctccaggcggtaagagatggttttgtcagggccaga
atcgatggcgaaatcatgctgctcgaagatgcccaaaaactggacaaaaatattaagcat
gatatagaggttatagttgatcgtttgatagttaaatcagggatcagagaaagactggct
gattcggttgagaccgctttagaatatgctgatggcctggttatgatcaatgaggttgat
ggtgaaacaacaacctacagtgaaaagtttgcctgtgttgattgtgggatcagtttagaa
gaaaaatccccaagaatgttttcttttaacagtccttatggggcctgtgagaattgtggt
ggtctgggggttaaaaaagaatttgacccggaattgatcctggatcaggacaaatcaatt
gctgatggagggataatcccctggaaaaactcttccagccgctattatccagccctttta
gaggctttagctgaaaaacatgattttagccgtcagactccacttaaaaaactggatgaa
gatttaattaaactgctcctttatggcagcaaagaaaagatcaccttcccttataccaat
cgttatggtaggaccagggaccatacaactaaatttaagggggtaatcggctatttgcaa
aaacggatgagtgattctgattcacccggaacccataaacggatggaaagatatatgaac
gaaataccctgtcaggtttgtgggggccagcgtttaaagccggaggtactcgcagtaaca
atcggtggactttctatagcagaatttacttctttttctattaaagatgcctatgatttt
ttagaagaggtagattttgatgaaagaagggcttatataggcaaagagatcctcaaagaa
gtcaaggccagactgcgttttttacttgatgttggtctggaatatttaacccttgaccgt
tctgccggaactctttctggaggagaggcccagcgaatcaggctggcaacccagataggt
tcaggtctagtcggggtattatatatacttgatgagccgagtatcggccttcatcaaaga
gataataatcgtttgatcaacaccttagagcatattcgtgatcaaggtaacacagtaata
gtggttgaacatgatgaagaaactattcgttcagctgatcatattattgatattggacct
ggagcaggaaaacacggaggagaaattgttgctgaaggcaatgttgatgatattatcaat
gaaaaaaggtctttaacaggtcagtatttaaatggcagtaagaagatcgagattcctgaa
gatagatatcaaccgaatggtaattggttgactattgaaggggccaggcagcacaatctt
aaaaatatagatgttgatattcctctgggaacttttacctgtgttacaggagtttcaggt
tcaggtaaaagcactctggtcaataatgttttaaaaagaagattgatgcaagaaatctat
gattctacccttcatcccggagatcacgatgggataaaaggtttagaacaggtagataag
gtgatcaatattgatcagtcaccaatcggaagaacaccgcgatctaatccggtaacctat
accaaggtttttaactatattagagatgtatttgccagtactccagaagccaaacagcgt
ggttatgaaattggccgtttcagctttaatgttaagggaggccgctgtgaagcctgcaaa
ggccagggagaagaacagatagaaatgcactttttgcctgatgtttatgttccctgtgag
gtctgtgatggcaaaagatataatagggagaccttagagataaaatacaagggtaaaagt
atagctgatgttttggatatgaatgtagaggaagctcttgagttttttgagaatattgaa
accatcaggcgaagactgcagactctttatgatgttggcctgggttatattagattgggc
cagccggcaacaacactttccggtggagaagctcaacgggttaaaattgctaaagagttg
ggtaaaagaagtaccggtcagacaatttatttattagatgagccgacaaccggactccat
tttgatgatgtaaaaaaacttctaagtgtacttcaccgtttaagagaagatggtaataca
gtcatcgtaatcgagcataatttagatgtgataaaatctgctgattatattattgattta
ggaccagaaggtggagaaaaaggtggacagttaattgccaaaggtagcccggaagatgtt
gcaaataatgagagctcatatacaggtaggtttttaaaagatatactttag

DBGET integrated database retrieval system