KEGG   Halanaerobium hydrogeniformans: Halsa_0483Help
Entry
Halsa_0483        CDS       T01349                                 

Definition
(GenBank) extracellular solute-binding protein family 5
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
has  Halanaerobium hydrogeniformans
Pathway
has02024  Quorum sensing
Module
has_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:has00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Halsa_0483
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:has02000]
    Halsa_0483
Transporters [BR:has02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Halsa_0483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 Lac_bphage_repr
Motif
Other DBs
NCBI-ProteinID: ADQ13956
UniProt: E4RPS2
Position
563735..565336
Genome map
AA seq 533 aa AA seqDB search
MRSKFLLYLFVPILVIGLSLGVSAERVPELNIMTTTEGYDPVRYEAAFLIQENLAELGIE
VNVSPTEFSTLIQNFYNEQDFEIAIAGWSGRVDRLDPQHFLGTLESGQADLGGNNPGGYV
NERYDELFQMQSKEFDQDLRREYVLEMQEIAMDEQPVNILFFRDEVVAYNRDNFTGFVPM
AGEAIYNEWIPFDVEPLTDDRSLTIGTTQEPDNINPLDSTTVWGWKFMRMYYDKLIRLSP
DIEPLPWAAESVEAIDDNTIEIVLRDGMYFHDGEPVTVDDVKFSYDYYQEQDFAYFRPFY
QPLEEVIVVDDNTLHFVLEEPTSFFITVTLSQIPILPKHLWEDIEAADQLSPEDVPTVGS
GPLVFDQYDRGEYKRLVKNEDYFKADEIDIDAVDFNIYADSEGVYTALVTEEIDMTAWRL
EPAQIDLAEQEDHLEVVSVPDFGYYHMTYNLRVPPMDDIEFRRALAHAVPYETFINVLLD
GLGERGTSIIAPVNSFWHNPDVPLYDYDLDLARERLEEAGYWWDDEGRLNFPQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaagtttttactctacttatttgtaccaattcttgtaatcggattgagtttg
ggagtctcagcagaaagggtacctgaattaaatatcatgacaactacggaaggttatgat
ccggttcgttatgaagcggcttttttaattcaggaaaatttagctgaattgggaattgag
gtcaatgtttctccaaccgaatttagtacattaattcaaaatttctataatgaacaggat
tttgaaattgctattgcaggttggtcaggcagggttgatagacttgatcctcagcacttt
ttaggcactttagagtctggacaggctgatcttggtggtaataatccgggtggctatgta
aatgaaagatatgatgagctatttcagatgcagtcaaaagaatttgaccaggatttaaga
agagaatatgttctggaaatgcaggaaatagctatggatgaacagcctgttaacatactc
ttttttagagatgaggttgtagcatataatagagataatttcacaggttttgtgccaatg
gcaggagaagctatttataatgaatggattccctttgatgttgagcctttaactgatgat
agaagtctaacaatcggaacaacccaggagccggataatattaatcctcttgattccaca
acagtttggggctggaaattcatgaggatgtattatgataaattaatccgtctttcccca
gatattgagcctttaccatgggctgcagaatctgtagaagcaattgatgataatacgatc
gagatagttttaagagatggaatgtacttccatgacggtgaacctgtaactgtagatgat
gttaaatttagttatgattattatcaagaacaggattttgcttactttaggcctttttat
cagcctttagaagaagttatagttgttgacgataatacattgcattttgttctcgaagaa
ccaacatcattctttataacagtaactttaagtcagattcctattttacctaaacacctc
tgggaagacatcgaagctgcagatcagctttctccagaagatgtaccaactgtaggaagt
ggaccactggtatttgatcaatatgatcgtggtgagtacaaacgactggttaaaaatgaa
gattactttaaagcagatgagatagatattgatgcagttgattttaatatttatgccgat
tctgaaggggtttatactgctttagtaacagaagaaattgatatgactgcctggagattg
gaaccagctcaaattgatcttgccgaacaggaagatcaccttgaagtagttagtgttcct
gattttgggtattatcatatgacctataatttaagagttcctccaatggatgatatagaa
ttcagaagagctttagcccatgcggtaccttatgaaacatttataaatgttctgctggat
ggcttaggtgaaagagggacttcaataattgctcctgttaattctttctggcataatccg
gatgttcctctctatgattatgatctcgatttagccagagaaagattagaagaagcaggt
tattggtgggatgatgaaggtagactgaatttccctcaataa

DBGET integrated database retrieval system