KEGG   Halanaerobium hydrogeniformans: Halsa_0484Help
Entry
Halsa_0484        CDS       T01349                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02033  peptide/nickel transport system permease protein
Organism
has  Halanaerobium hydrogeniformans
Pathway
has02024  Quorum sensing
Module
has_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:has00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Halsa_0484
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:has02000]
    Halsa_0484
Transporters [BR:has02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Halsa_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Tweety
Motif
Other DBs
NCBI-ProteinID: ADQ13957
UniProt: E4RPS3
Position
565434..566423
Genome map
AA seq 329 aa AA seqDB search
MGKGQFFAKRIIQLIITFFIILTILFFLFRLALPDPTAALVMDGLSAEEQALVRARFGLD
RPLVEQYFIYLRNFMTGEFGMSFHYKSAVFPILMEKLFNTLALMLPAIFISYLIGPLLGV
LLSWKRGSNTEFAGIVGGLFLRSAPVFWTGMIFIMIFGIWLGILPTSGMRTLPYTASGNF
DKIMTLDYLRHLILPMTTIALYYLGLPMLIMRNTMLEIMGEDFIELCQAKGLSERKIMYK
HVARNALLPVVTQAAITIGLAVGGQVVVEVVFSWPGLGREMIQAVRTSDFPMAQSAFMMM
AGLVLIMNTAADLLYSYLDPRVVLKGGNK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggacaatttttcgcaaaaagaataattcaattaataataactttttttata
attttaactatactattttttctgtttcgtttggctttacctgatccaactgcagctctg
gttatggatggactttctgcagaagagcaggcactggtcagggctcgttttggtcttgat
aggccattagtagaacagtattttatttatttaaggaattttatgacaggtgaatttggg
atgtcatttcattataagtcggctgtttttccgattttgatggaaaaactttttaatacc
ctggctttgatgttgccagcaatttttatttcttatttgatagggccacttttgggagtg
ttattatcctggaaaaggggaagtaacaccgaatttgcaggtatagtaggggggctcttt
ttgcgttctgcccctgtattttggaccggtatgatttttattatgatttttgggatctgg
ctgggtatattaccaaccagtgggatgagaaccctaccttacacagcaagtggtaacttt
gataaaataatgactttagattatttgcggcatcttatcttgccgatgacgactatagcc
ctctattatcttggtctaccgatgctgataatgaggaatactatgttggaaattatgggt
gaagattttatagaattatgtcaggcaaagggtttaagtgaacgcaagataatgtataaa
catgttgcccgtaatgctcttttacctgttgtgacccaggctgcgattacaattggcctt
gcggttggcggacaggtagtagtagaggtggtcttttcctggccgggattgggtagagaa
atgatccaggctgttcggacaagtgattttccgatggcccagagtgcttttatgatgatg
gccggtctggtcttaattatgaacacagcagctgatttgctttatagttatttagatccc
cgggttgtacttaaggggggaaataaataa

DBGET integrated database retrieval system