KEGG   Halanaerobium hydrogeniformans: Halsa_0505Help
Entry
Halsa_0505        CDS       T01349                                 

Definition
(GenBank) PAS sensor protein
Organism
has  Halanaerobium hydrogeniformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_3 PAS_9 PAS_4 PAS GAF DUF4767 Rep_fac-A_C PAS_11
Motif
Other DBs
NCBI-ProteinID: ADQ13978
UniProt: E4RPU4
Position
complement(590829..592034)
Genome map
AA seq 401 aa AA seqDB search
MKSNLNTNLFDEENCKKLFTKNKKLALIIIQFNKKTKQAYIKFLSRGAEKLLGYQSTELI
DKNFAVILNKNQTNIISDIVNKALKNELKYEDIEIINKNRQKIKAELEIYPFKLKQKSKE
NLSFALNILDPDQCTEKLKSILNNVKNAIWSASWPDYKTYYISPSIKDIYGYEAEDFKNN
FKLWYECVHPDDRNKIKETYNDLHKTGFSQKEMRIIKKSGEIIWVEDQNRFIYNENNNPI
RIEGIVQDITERKKSDEKLEFQFDFQKLIADISSNFVKLDSDQFDEAVDYALKKVGSFFE
IDRSYLFLTSEDGSNSSNTHEWCRDGIEPKIDELQDLDNDSFPWFRDNLVNNHYVYIADT
DQLSEDAANKKKSLKDQKIKSLVAVAIFNKDELKGFLALNR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaacttaaatactaatttattcgatgaagaaaattgcaaaaaattattcacc
aaaaacaaaaagcttgctttaataatcatccagtttaacaagaaaaccaaacaagcttat
atcaaatttttaagccgtggagcggaaaaacttttaggttatcaaagcactgaattaata
gataaaaattttgcagtaattctaaataaaaatcagactaatataatttcagacatagtg
aataaagcattaaaaaatgaactaaagtatgaagacattgagatcataaataaaaatagg
caaaaaattaaagctgagctcgaaatatatccttttaaacttaaacaaaagagcaaagaa
aatttgagctttgctttaaatattttagatccagatcaatgcaccgaaaaactaaagagc
atcttaaacaatgtcaaaaatgcaatctggtctgcttcctggcctgattataaaacatat
tatattagtccttccatcaaagatatttatggttatgaagccgaagacttcaaaaataat
tttaaactctggtatgaatgtgtacatcctgatgatagaaataaaattaaagagacttat
aatgatttacataaaacaggattttcccaaaaagaaatgcgtatcatcaaaaaaagtggt
gagattatctgggtagaagatcaaaatagatttatatacaatgaaaacaacaatccaatt
agaattgaaggaattgtacaggatattacagaaagaaaaaaatcagatgaaaaattagaa
tttcagtttgatttccaaaaactcatagcagatatttcgtctaattttgttaaattagat
tctgatcaatttgatgaagcagtagattatgctttaaaaaaagtaggaagtttttttgaa
atagatcgtagttacttgtttttaacctctgaagatgggagtaacagcagtaatactcat
gaatggtgtagagatggtatcgagcctaagattgatgaacttcaggatttagataatgat
tctttcccctggtttagagataatttagttaacaatcattatgtttacattgctgataca
gatcaattgagtgaagatgcagctaataaaaaaaaatccttaaaagatcaaaagattaag
tctttagttgcagttgctattttcaataaagatgaattaaaaggctttctagctttgaat
cggtaa

DBGET integrated database retrieval system