KEGG   Halanaerobium hydrogeniformans: Halsa_0511Help
Entry
Halsa_0511        CDS       T01349                                 

Definition
(GenBank) Glutamate synthase (ferredoxin)
  KO
K00284  glutamate synthase (ferredoxin) [EC:1.4.7.1]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00630  Glyoxylate and dicarboxylate metabolism
has00910  Nitrogen metabolism
has01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Halsa_0511
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Halsa_0511
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.7  With an iron-sulfur protein as acceptor
    1.4.7.1  glutamate synthase (ferredoxin)
     Halsa_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG
Motif
Other DBs
NCBI-ProteinID: ADQ13981
UniProt: E4RPF8
Position
599237..603829
Genome map
AA seq 1530 aa AA seqDB search
MRFSRMPEKQGLYSPEFEHDACGMGFVSHIKGRKSHQIVEQALEVLVNLSHRGATGSEEN
TGDGAGILLQIPDQFLRAKALENDFKLPEVGDYGVGLVFLPREEEKRNVIVKIIEDITAD
EGQKVLGWRDVPVDSSEIGNSAREVMPYFKQLFIKRSAEIKAGIDFERKLYLIRKRLEKK
IRNSEYKGELYIASLSSRTLVYKGMLTPGQLKGFYPDLSDPELKSAIALIHSRFSTNTFP
SWERAHPNRYLIHNGEINTMLGNQNWMRGRESLFASKAFGNDLAELLPVINEDGSDSARF
DNALEFLYLSGRSLAHSMMMMIPEPWEHNDLMEEKKRDFYHFHSTLMEAWDGPAAMAFTD
GTQVGAVLDRNGLRPSRYYITDDDLLIVASEVGVLDLPEEKIVSKQRLEPGRMLLLDTEK
GRIINDKELKAEISAAEPYGEWLDDNLLKMEEINNMEDSEQDLEIDSKRLLRMQKSFGYS
YEDLQKILIPMARDGVDPIGSMGNDASLAVLSDQPQLLYNYFKQLFAQVTNPPIDSIREK
LITASKSYLGSEGNLLSPEAKSCRQLELEDPFLSNAQLKKIKELDQAGFKTAEIDIIFDK
EENDLEKAINEIFAKADSLIENGTNIIILTDKKINADKLPIPALLAVSALHHHLIKNGSR
TKVSIVLESGEPREVHHFALLIGYGLDAVNPYLAYASLVDLVKEGHLEMDSKKAVQKYIK
AAVKGVIKVMAKMGISTVQSYRGAQIFEAIGIGEEVIDKYFCRTPSRIGGIGLEEIAKES
QLRHDSAFKGIKIERDTLDPGSNFAWRKDGEEHLYNPETIYLLQRAVREDNYQLYKEYAA
KINDQSDKMLTLRGLLEPDYAAEAIPLEEVEPAENIMKRFKTGAMSYGSISQEAHEALAI
AMNRIGGKSNTGEGGEDPDRYTRDANGDLRNSAIKQVASGRFGVDSSYLVSAEEIQIKMA
QGAKPGEGGQLPGKKVYPWVAEVRGTTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANRN
ADINVKLVSEVGVGTVAAGVAKGKADVILISGYDGGTGASPRTSIRHAGLPWELGLAETH
QTLVLNDLRDRVKLETDGKIMTGKDLAVAAMLGAEEYGFATTPLVALGCVMMRVCNKNTC
PVGVATQDPELRKKFTGKPEHVVNFMRFMAENLREEMAALGFRTIDEMIGRVDRLGRDKA
FDHWKAKGLDYSAILHQPEVARKKAVFCQQKQEHGLENSYDLRELLELSKDAIENGEAIE
KDLPIKNTDRVVGTILGSEITKRYGGTGLKEDTIKLNFKGSAGQSFAAYLPKGLTFSLSG
DSNDYLGKGLSGGKVIVKKPAEASFKADENIIIGNVAFFGATSGKAYIEGVGGERFAVRN
SGVEAVVEGLGDHGCEYMTGGRVVVLGSVGRNFAAGMTGGTAYVLDLNGDFALKANQEMV
DLEALPEVEDGPIVKEMIKEHLAYTGSLKAEEILNNWEEYKHKFVRVMPRDYQRMITAIE
DFKQQGLCREDALMRAFEENAQDKARVSGN
NT seq 4593 nt NT seq  +upstreamnt  +downstreamnt
atgcgatttagtagaatgcctgaaaagcagggattgtacagtccagaatttgaacatgat
gcttgtggaatgggatttgtaagccatattaaaggaagaaagtcccatcagatagtggaa
caggcactggaagtgcttgtcaatttaagtcaccgaggagctacaggaagtgaagaaaac
actggagatggagcaggtattttgctgcagattccagatcagtttttacgagctaaagct
ctagaaaatgatttcaaactgcctgaagtcggtgattatggagtaggactggtcttccta
cccagagaagaagaaaaaagaaatgtgatagttaaaataatagaagatattactgcagat
gaggggcaaaaagttctcggttggagagatgtaccagttgattcttctgaaattggtaat
tcagccagagaggttatgccctattttaagcagctttttattaaacgctctgctgaaata
aaagcagggattgattttgaacgcaaactatatttgatccgtaaaagattggaaaaaaag
attcgaaattcagaatataagggtgagctctacattgcctcactttcaagccggacttta
gtctataaaggtatgttgacaccaggtcagctaaaaggtttttatccagatctcagtgat
cctgaacttaaatcagcaattgccctgattcattcacgttttagcacaaatacctttccc
agctgggagagagcccatcccaatcgctatttaatccataatggtgagataaatactatg
cttggtaaccagaattggatgcggggaagagagagtctatttgccagcaaagcttttggg
aatgatttagctgagcttctgcctgtaatcaatgaagatggcagtgattcagctcgattt
gataatgccctggaatttctttatttatctggacgttctctggcccattcgatgatgatg
atgattccagaaccatgggagcacaatgatttaatggaagagaaaaaaagagatttttat
cattttcatagtactttaatggaagcctgggatggtccagcagccatggcttttacagat
ggaacccaggttggagctgtgcttgatagaaatggactccgtccctcccgttactatatt
accgatgatgatcttttaatagttgcttctgaagtgggagtattagatctaccggaagaa
aagatagtcagcaaacagaggttagagcccggcaggatgcttttattagatactgaaaag
ggtagaattatcaatgataaagaacttaaagcagaaatttcagcagctgaaccgtatgga
gaatggctggatgataatctgcttaaaatggaagagataaataatatggaagatagtgag
caggacttagagattgattccaaacggctgctcagaatgcagaaaagttttggctacagt
tatgaagatctgcaaaaaatattgattccaatggctagagatggagttgatccgatcggt
tctatgggtaatgacgcctctttggctgttttatctgatcaaccccagcttttatataac
tattttaaacaattatttgcccaggtaacaaaccctcccattgattcgattagggagaag
ttaattaccgccagcaaatcatatttaggttcagaaggcaatctgctttctcctgaagct
aaaagttgtagacagttggaattagaagatccatttttgagcaatgctcaacttaaaaag
attaaagaacttgatcaagctggttttaaaacagctgaaatagatattatatttgataaa
gaagaaaatgatttagaaaaagcaatcaacgaaatttttgctaaagcagatagtttaatt
gaaaatggaacaaatattattattttaacagataaaaaaatcaatgctgataaactgccg
attccagcccttcttgccgtatctgctttacaccatcatctgattaaaaatggaagcagg
acaaaggtctccatagtcttagaatcaggagagccaagagaggttcatcattttgcactt
ttgatcggttatggtctggatgctgttaacccatatttagcctatgcttccctggttgac
ttagttaaggaaggtcatttggagatggacagcaaaaaggctgtgcaaaaatatattaag
gcagctgttaaaggggttatcaaggtaatggccaagatgggtatttcaactgtacaaagc
tacagaggagcccagatttttgaagcgatcgggattggagaagaagtgatcgataaatac
ttctgtcgtacaccttctcgaattggtggaataggcttagaagaaatagcaaaagaaagc
cagctcagacatgatagtgcctttaagggaattaaaatagaaagagatacccttgatcct
ggaagtaattttgcctggcgaaaagatggagaagaacatctatacaatccggaaaccatc
tacctgctgcagagagcagttagggaagataattatcaattatataaagaatatgcagct
aaaataaatgaccaaagtgataaaatgctaaccttaagaggactgcttgagcctgattat
gctgcagaagctattcctttagaagaggttgagccagctgaaaatataatgaagcgcttt
aaaacaggtgctatgtcatatggttcaatcagccaggaagcccatgaagctttggccatt
gcgatgaatagaatcggcggtaagtcgaacaccggtgaaggtggagaagaccctgatcgt
tatactcgcgatgccaatggtgatctccgcaatagtgcaattaaacaggttgcttcaggt
cgctttggagttgattcaagttatctcgtttctgctgaggagatccagatcaagatggcc
cagggtgctaaacccggtgaaggtggtcagctgcccggcaagaaggtttatccctgggta
gctgaagttaggggaacaacacctggtgttggcttgatctccccccctcctcatcatgac
atttattctatagaagatctggcccagctgattcatgatctaaaaaatgccaatcggaat
gccgacataaatgttaaattggtatctgaggttggggtagggaccgtagcagctggagtg
gccaagggtaaagcagatgtaattttaatctctggttatgatggtggtacaggtgcttct
cccagaacaagtattagacatgcaggtttaccatgggagctcggtctggctgaaactcat
cagactctggttttgaatgatttaagagatagggttaaattagaaactgatggtaagatt
atgacaggtaaagaccttgcagttgctgcaatgctgggagctgaagaatatggttttgct
acaacacctttagttgccttaggttgtgttatgatgcgggtctgtaataaaaatacctgt
ccggttggagttgcaacccaggacccggaattaagaaagaaatttacaggtaaaccggaa
catgttgttaattttatgcgctttatggctgaaaatctcagagaagagatggcagcctta
ggttttagaacaattgatgagatgataggccgggttgatagattgggtagagataaggct
tttgatcactggaaggcgaagggacttgattattcagcgattttacatcaacctgaagta
gccagaaagaaagctgttttctgtcaacaaaaacaggaacacggtctggaaaatagttat
gatttgagagaactgcttgagttatcaaaagatgccattgaaaatggagaagcaatagaa
aaagatctaccgattaaaaatactgacagggtggttggaaccattcttggtagtgaaata
acaaagagatatggtggaactggcctaaaagaagatacgatcaaattgaacttcaaaggt
tcagctggacagagttttgccgcctatttacctaaaggattaacatttagccttagtgga
gatagcaacgactatcttggtaaaggactttctggtggtaaggtaattgttaaaaaacct
gctgaagcttcatttaaggctgatgaaaatatcattattggtaatgtagccttttttggt
gcaacttctggtaaagcctatatagaaggagttggcggggaaaggtttgcagtccgcaat
agtggagttgaggcggtagttgaaggccttggagaccatggttgtgaatacatgacaggt
ggtagggttgttgtactcggctcggttggccgcaattttgctgccgggatgaccggtgga
actgcttatgtgcttgatcttaatggagattttgctttaaaggccaatcaagagatggtt
gatttagaagctctgcctgaggtagaagatggcccgatcgttaaagaaatgataaaagaa
catttagcttacacaggtagtcttaaagcagaagaaatcctgaacaactgggaagagtat
aagcataaatttgtgagggttatgccgagagattatcagcggatgattacagcaatcgag
gactttaaacagcagggattatgtagagaagatgccttaatgagagcttttgaagaaaat
gcccaggataaagcccgtgtcagcggtaactaa

DBGET integrated database retrieval system