KEGG   Halanaerobium hydrogeniformans: Halsa_0562Help
Entry
Halsa_0562        CDS       T01349                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
has  Halanaerobium hydrogeniformans
Brite
KEGG Orthology (KO) [BR:has00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Halsa_0562
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Halsa_0562
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Halsa_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ADQ14027
UniProt: E4RPK4
Position
666863..667885
Genome map
AA seq 340 aa AA seqDB search
MNKAIIAITMGDPAGIGAEIIVKALNNKDIYEKANPVVVGSSNFLKDAVNLIPSNLKINP
VESVDDIKGEYGTIDVMDLENIQLSDIQYGVVDKKAGKAAVEYIFKAIELAKEKKIDAVV
TGPINKEAINAAGFHYSGHTEIFAEKTETDDYAMMLADDEMKVIHVSTHVSLREACDLVK
KERILTVINLADQALKSLSIKEPKIAVAGLNPHCGEQGLFGSEEAREISPAVKEAQKAGI
NAEGPISPDTIFSKVRGGQYDIAVVMYHDQGHIPMKVIGFQYNQKLEKWESVSGVNITVG
LPIIRTSVDHGTAFEIAGEGKANQESMIEAIEMAIQFTEN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagccattatagcaattacaatgggtgatcctgcaggaattggagcagaaata
atagtaaaagctttaaacaataaagatatttatgagaaagctaatccagtggtggttgga
agctctaatttcttaaaagatgcagtgaacttaattccatctaacttaaaaattaatcct
gtcgaatctgtagatgatattaagggagaatatgggacaatagatgtaatggatttagaa
aatatccaattaagtgatatacaatatggtgttgtagataaaaaagctggaaaagctgca
gtagaatatatttttaaggcaatagaactagcaaaagagaaaaaaattgatgctgtagta
actggtcccataaataaagaagctataaatgctgctggttttcattattcaggccataca
gagatttttgctgaaaaaactgagacagatgactatgcaatgatgctggcagatgatgag
atgaaagttattcatgtatccactcatgtttcacttcgtgaagcctgtgatttagttaaa
aaagaaagaattttaaccgtaataaatctggccgaccaggcattaaaaagtctgagtatt
aaggaacctaaaatagcagttgctggacttaatccgcactgtggggaacagggattattt
ggtagtgaagaagcgcgcgaaatatcccctgctgttaaagaggcacaaaaagctggcatt
aatgctgaaggtcctatttctccagatacgattttttctaaggttagaggtggtcagtat
gatattgcagttgtaatgtatcatgatcaagggcatataccaatgaaggtaataggcttt
caatataatcaaaaattagaaaaatgggaatcggtaagtggtgttaatattacagttggt
ctaccaattattagaacttcagttgatcatggtacagcttttgaaattgcaggtgaagga
aaagcaaatcaggagagtatgatcgaggctatagaaatggcaattcaatttacagaaaat
taa

DBGET integrated database retrieval system