KEGG   Halanaerobium hydrogeniformans: Halsa_0733Help
Entry
Halsa_0733        CDS       T01349                                 

Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00220  Arginine biosynthesis
has00250  Alanine, aspartate and glutamate metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01130  Biosynthesis of antibiotics
has01230  Biosynthesis of amino acids
Module
has_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Halsa_0733
   00220 Arginine biosynthesis
    Halsa_0733
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:has04147]
    Halsa_0733
Enzymes [BR:has01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     Halsa_0733
Exosome [BR:has04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Halsa_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC Oxygenase-NA
Motif
Other DBs
NCBI-ProteinID: ADQ14183
UniProt: E4RMW6
Position
837034..838248
Genome map
AA seq 404 aa AA seqDB search
MKIEKDKINKILLAYSGGLDTSVAIKWLQDKYDAEIITYTADLGQKQDWDEVEAKALKTG
ASKAYIDDIREEFITDYVYPALKVNALYQEKYPLATALARPLIAKRMVEVAKKENVDALA
HGCTGKGNDQVRFEVTFKALAPELAILAPLRDWGFTSRDDEIEYAAENNIDVKATKDSPY
SIDQNLWGVSIECGILEDPWAEPPSDAYLWTKDVDDTPEEPKYIEIEFEKGVPTAVDGEK
LSPIQIVNKLNEAGSEYGVGRIDMVEDRLVGIKSREIYEAPAGEILITAHKALESLTLDR
ESKNYKAEMAAKYAELCYYGLWFSPLRDALDAFVDKTQSYVSGTVKVKLYKGNCTLAGRK
SDYSLYDHGLATYDESDVFDHESAAGFINLWALPVQVANEKNRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaaaaagacaagatcaacaaaattttattggcctattctggtggtttagat
acctcagtagctattaaatggctgcaggataaatatgatgcagaaatcataacctatact
gctgatttaggtcaaaaacaggactgggatgaagttgaagcaaaggcacttaaaacaggg
gcttctaaagcatatatcgatgatatcagagaagaatttattactgattatgtttacccg
gctttaaaggtaaatgccttatatcaggaaaaatatccccttgccacagccttagccaga
cctttaattgctaaaagaatggtcgaggttgctaaaaaagaaaatgtagatgcacttgct
cacggctgtacaggtaaaggtaatgaccaggtaagatttgaggttacctttaaagcactt
gcacctgaacttgcaattttagcaccacttagagactggggttttacctctagagatgac
gaaatagagtatgcagcagaaaacaatattgatgttaaagctaccaaagatagtccttac
agtattgatcaaaatctctggggagtcagcatagaatgcggtattttagaagatccctgg
gctgaaccaccttctgatgcctatctctggacaaaggatgtagatgatactcctgaagag
cctaaatatattgaaatcgaatttgaaaaaggagttccaactgcagttgatggagaaaaa
ttatctccaatccaaatagtaaacaagttgaatgaagctggttctgaatatggagttggc
aggattgatatggtagaagataggctggttggaattaagtcaagggagatctatgaagct
cctgcaggtgaaattctaatcacagctcacaaagccttagaatctcttaccttagatagg
gagagcaaaaactataaagcagaaatggccgctaaatatgcagaactatgctattatggt
ctctggttttcaccgctgagagatgccttagatgcttttgtagataaaactcaaagctat
gtaagtggaacagttaaggttaaactttataaaggtaactgtactctggctggaagaaaa
tcagattactccttatatgaccacgggcttgccacttatgatgaaagtgatgtttttgat
catgaatcagcagctggctttatcaacctctgggcattacctgttcaggttgcaaatgaa
aaaaatagaaaataa

DBGET integrated database retrieval system