KEGG   Halanaerobium hydrogeniformans: Halsa_0925Help
Entry
Halsa_0925        CDS       T01349                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:has00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Halsa_0925
Enzymes [BR:has01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Halsa_0925
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Halsa_0925
    1.1.1.-  
     Halsa_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: ADQ14371
UniProt: E4RQ04
Position
1059443..1060516
Genome map
AA seq 357 aa AA seqDB search
MGKKMKAALWYGPKDIRIEDVDVPKVKSGQVKIKVEWCGICGSDLHEYMVGPIFIPYKQK
HPLTKMEAPIIMGHEFAGEVVEKADDVSNLEVGDKVTLEPIVACGECPNCQKGYYNICES
LGFHGLAGGGGGLAEYTTFPAEFVHKLPDGVSTKEGALIEPIAVAVHSLRRADFLQGETA
IVTGAGPIGLSTILSLKAAGAQQVISVEIADARKKFALEFGADHVLDPNEVDVIEEVNKL
TDNKGVDVGFETTGVQAGFETAVAATARRGRIVVTSIWEEAVEFNLNNLVLTEKEIKGTI
AYSKGVFPAVISLIKDGRIKASKMITEEIKLSDLVDKGFEELMGHKDKHVKIIVKPS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaaaatgaaggcagctctttggtatggacctaaagatataagaatagaagat
gttgatgttccaaaagtaaagtccgggcaggttaaaattaaagtagaatggtgtggaatc
tgtggctctgacttacatgaatatatggttggaccaatttttataccttataaacaaaaa
caccctttaacaaaaatggaagctccgattattatgggccatgaatttgcaggagaagtt
gttgaaaaagcagatgatgtctctaatttagaagttggtgataaagtaactttagaacct
atagttgcctgtggtgaatgtcctaactgtcaaaaaggatattataatatctgtgaaagc
ttaggctttcatggtttagctggtggaggtggaggactggcagaatatacaacattccct
gctgaatttgtccataaacttcccgatggagtaagcactaaagaaggtgctttaattgaa
ccaatagcagtagctgtacactctctaagaagagcagactttttacagggagaaacagct
atagttacgggagccggtccgattggtctttcaacaatactctcattaaaagcagccggt
gctcagcaggttatttcggtagaaattgcagatgctcggaaaaagtttgccctggaattt
ggagcagaccatgttttagatcccaatgaagttgatgtaatagaagaagttaataaatta
acagataataaaggtgtagatgttggttttgaaacgacaggtgtccaggctggttttgaa
acagcagttgcagccacagccaggagaggtagaattgttgtaacaagtatctgggaagaa
gctgtagaatttaatcttaataatctggttttaactgaaaaagaaataaaaggtacaatc
gcctattcaaaaggtgttttcccggcagttatttctttaattaaagatggtagaatcaaa
gcttctaaaatgataacagaagagattaaactaagtgatttagttgacaaaggatttgag
gagttaatgggtcacaaagataaacatgtaaaaatcatagtaaaaccatcttaa

DBGET integrated database retrieval system