KEGG   Halanaerobium hydrogeniformans: Halsa_1169Help
Entry
Halsa_1169        CDS       T01349                                 

Definition
(GenBank) Fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00030  Pentose phosphate pathway
has00051  Fructose and mannose metabolism
has00680  Methane metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
has01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_1169
   00030 Pentose phosphate pathway
    Halsa_1169
   00051 Fructose and mannose metabolism
    Halsa_1169
  Energy metabolism
   00680 Methane metabolism
    Halsa_1169
Enzymes [BR:has01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Halsa_1169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Peptidase_M3_N Phage_min_cap2
Motif
Other DBs
NCBI-ProteinID: ADQ14600
UniProt: E4RK48
Position
1318679..1320637
Genome map
AA seq 652 aa AA seqDB search
MEELKYLKLLSKQFPNIPAVSTEIINLKAILNLPKSTEHFLTDLHGEHEAFQYMLKTASG
VIEYKINNIFDKELNEVEKRDLATLIFYPEEKMEKIENKNIDGLTEEWYKDSLDKIIKLC
KEVSSIYTRSKVRKALPEEFAYIIEELLHLRDDDENKKDYHEQITSTIIEIGQAKNFIKS
LSELIQTFAVDKLHIIGDIYDRGPNPHKIMDVLKNHHNVDIQWGNHDILWMGAGLGHKPL
IATAIRIALRYGNLEMIEEGYGINMRPLARLAMENYKGDICDVFCPKLLDKELEEKELRI
STQMQKAIAIIQFKLEGSLIKRRAEFNMNEALYLEKIDYDKGILYLNDNEIELTDKNFPT
IDPDDPYQLSPQEEEVINQLSESFKNNDKLQEDIRFLFNNGSMYKKYNGNLLFHGCVPLN
EDDDFACVDVGGRRAKGKELLDFFQDIIRKSYSDTNGDEDQRDWLWYLWRGEYSPLFGKD
RMTTFLRYFTDEDDKSLYKENKNPYYKARENEFTCKKILSEFGVDPEKGHIINGHTPVEE
KRGESPIKGNGRLLVIDGGISAAYQKKTGIAGYTLAYTHSELRLISHEPFISKEEALTKR
SHDTVSSIRIMKFDGQQKIADTDNGAKLQDDVKYLNKLLEAYEKGIIKEKYK
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattaaaatatttaaagcttttatctaagcaatttccaaatataccagctgtg
agcacagaaattataaacttaaaggcaattttaaatctgcctaaaagtacagaacatttt
cttactgaccttcatggtgagcatgaggcgtttcagtatatgcttaaaacagcttctgga
gtaatagaatacaagattaataatatttttgataaagagttaaatgaggttgaaaaaaga
gatttagcaactttaattttttatccagaagaaaaaatggagaagatcgaaaataaaaat
atagatggtttaactgaagaatggtataaagattctttagataaaattattaaattatgt
aaagaagtttcttcaatttatacccggtctaaagtaagaaaagctttgcctgaagaattt
gcctatattatagaagaacttcttcacttaagagacgatgatgaaaacaaaaaagattat
catgagcagattacttcaacaattattgaaattggacaggctaaaaattttataaagtct
ctttcagaattaattcaaacatttgctgtcgataaacttcatattattggcgatatatat
gacagagggccaaatcctcataaaataatggatgttttaaaaaatcatcataatgtagat
atacagtggggaaatcacgatatactctggatgggagcaggtttaggccataagccgttg
attgcaactgctattagaattgctttaagatatggtaatttagaaatgattgaagaaggt
tatggtattaacatgagacctttagcaagactggctatggaaaattacaaaggggatatt
tgtgatgttttttgtccgaaattacttgataaagaactagaagaaaaagaacttagaata
agtactcagatgcaaaaagctatagctataattcagtttaagttagaaggtagtttgatt
aaaagaagagccgagtttaatatgaatgaagcactttatttagaaaagatagattatgat
aaaggaatactttatttaaatgacaatgaaattgagctgactgataaaaactttccaact
attgatcctgatgatccatatcaattaagtcctcaagaagaggaggtaattaatcaatta
agtgagtcatttaaaaataatgataaacttcaggaagatataagatttttatttaataat
ggcagtatgtataaaaaatataatggaaatctcttatttcatggctgtgtacctttaaat
gaagatgatgattttgcctgtgttgatgttggtggacggagagcaaaaggtaaagaactc
cttgatttcttccaggatataatccgtaaaagttattctgatacaaatggagatgaagat
caaagagattggctctggtatctctggagaggtgaatactcacctttattcggtaaagat
agaatgacaacatttttacgttactttactgatgaagatgataaatctttatataaagaa
aataagaatccttattataaagcaagagaaaatgagttcacctgtaaaaagatcttatct
gaatttggtgttgatcctgaaaaaggtcatattattaatgggcatacaccagttgaagaa
aaaaggggtgaaagcccaattaagggaaatggaagactgcttgtaattgatggtggaatt
tcagctgcctatcaaaagaaaactggtatagcaggttatactttagcatatactcattct
gaattgagattaatctctcatgaaccgtttatctctaaagaagaagctttaacaaaaaga
agtcatgatactgtgtcatcaatcagaataatgaaatttgatggtcaacaaaaaattgca
gacacagataatggagcaaaattacaggatgatgtaaaatatttaaataaacttcttgaa
gcatatgaaaaaggcattattaaagaaaagtataagtaa

DBGET integrated database retrieval system