KEGG   Halanaerobium hydrogeniformans: Halsa_1755Help
Entry
Halsa_1755        CDS       T01349                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00260  Glycine, serine and threonine metabolism
has00680  Methane metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
has01200  Carbon metabolism
has01230  Biosynthesis of amino acids
Module
has_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
has_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_1755
  Energy metabolism
   00680 Methane metabolism
    Halsa_1755
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halsa_1755
Enzymes [BR:has01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Halsa_1755
Membrane trafficking [BR:has04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Halsa_1755
Exosome [BR:has04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Halsa_1755
  Exosomal proteins of melanoma cells
   Halsa_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADQ15174
UniProt: E4RIV4
Position
complement(1956771..1957523)
Genome map
AA seq 250 aa AA seqDB search
MIIVKKIVFVRHGQSEWNLANKFTGWTDVDLSEQGIKEAEAAGEILEKEGFTFDLAFTSY
LKRATKTLNIILDIMDLHWIPVIKSWKLNERHYGDLQGLNKAEMTEKVGEEQVHIWRRSF
DTPPPALDADDSRHPKNESKYDELSEAELPDSESLKMTIKRVMPFWEKTIVPKIKEGRKI
IISAHGNSLRALVKHLDNISDEEISSLNIPTGRPLVYEFDEEMNVLDSYYLGDQEEIDAE
MQKVKDQAKS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgataattgtgaaaaaaattgtttttgttagacacggtcaaagtgaatggaatttagca
aacaaatttactggctggactgatgtagatttaagtgagcagggaataaaagaagcagaa
gcagcaggtgaaatattagaaaaagaaggatttacatttgatttagcattcacctcttat
ttaaaaagggcaacaaaaactttgaatattattttagatattatggatttacactggata
cctgttataaaatcttggaaattaaatgaaagacattacggtgatttacaaggtttaaac
aaggcagaaatgaccgaaaaggttggtgaagaacaggttcatatttggagaaggagtttt
gatactccaccacctgctttagatgctgatgattctcgccaccctaaaaatgagagtaaa
tacgatgaactttcagaagcagaacttccagattctgaaagcctaaaaatgacaattaaa
agagttatgcctttctgggaaaaaacaattgtacctaagattaaagaaggtagaaaaatt
atcatctcagcccatggtaatagtttaagggcacttgtaaagcatttagataatatctct
gatgaggaaattagttctttaaacattccaacaggtagaccacttgtttatgagtttgac
gaagaaatgaatgttttagatagttattatttaggagatcaagaagaaattgacgcagaa
atgcagaaagttaaagatcaagcaaaatcttga

DBGET integrated database retrieval system