KEGG   Halocynthiibacter arcticus: RC74_02270Help
Entry
RC74_02270        CDS       T04275                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hat  Halocynthiibacter arcticus
Brite
KEGG Orthology (KO) [BR:hat00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    RC74_02270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AML50247
UniProt: A0A126UWI4
Position
457708..459189
Genome map
AA seq 493 aa AA seqDB search
MSDSPKTNQWQTLDKDLNRISQLESATAYVSRPLVAPGIALAFIALTIITAAIFFDATSS
NFVVIAAAGFGAYMAINIGANDVANNMGPAVGANALTLGSAIVIAAFFESAGALIAGGDV
VSTISKGIIDPASFTDTKVFIWAMMAALISSALWVNLATFVGAPVSTTHSVVGGVMGAGI
AAAGFSVVNWPTMGTIAASWVISPVLGGAIAAACLAFIKAKIIYQDDKIAAARKWVPVLM
GVMAAAFSAYLSLKGLKKIIEIDIGMALLIGAGIGAVVYVVSAPLIKRQSEGLENRNKSL
KALFAAPLVISAAMLSFAHGANDVANAVGPLAAIVHAAEFGDFSSKVEIPLWVMVIGALG
ISFGLVLFGPKLIRMVGSQITKLNPMRAYCVALSAAVTVIIASWLGLPVSSTHIAIGGIF
GVGFYREWSTERRLAKSRETRAPEKRIAVEERRRRKLVRRSHFMTIIAAWVITVPAAAIM
SAGIFYFLNFVIG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattctccaaagaccaaccagtggcagacgctggacaaagaccttaaccggatc
agccagcttgagtcagcgaccgcatatgtgtcgcggccgttggtggccccaggtatcgca
ctcgcctttattgcgctgaccatcattaccgccgccattttctttgacgccacttcgtcc
aatttcgttgtcatcgctgcggcaggttttggcgcgtatatggcgatcaatattggcgcc
aacgacgtcgcgaacaacatgggcccagcggttggcgccaacgccctgactttggggtcg
gccattgttattgctgcatttttcgagagtgcgggagccttgatagcgggcggagatgtt
gtttctacgatctcaaaagggattatcgaccccgcgagctttacggacaccaaagtattc
atctgggccatgatggccgccttgatcagctcggccctttgggtcaacctcgcaaccttc
gtcggcgcacctgtttccaccacccactctgtggttggcggcgtcatgggcgcggggatc
gcggcggctggcttttctgtggtgaattggccaacgatgggaacaatcgcggcaagttgg
gtaatttctccggttttgggcggcgcaatcgcggcggcgtgtctggcatttatcaaagcg
aaaattatctatcaggacgacaaaatcgcagcggcgcgcaagtgggtgcctgttttgatg
ggagtcatggcggcggctttttcggcgtatctttcgcttaaaggcttgaaaaaaatcatc
gaaattgacatcggcatggcgttgttgattggcgcgggtatcggcgcggttgtctatgtt
gtttctgcgccgctgatcaaacgccagtctgaagggcttgagaatcgcaacaaatccctc
aaggcgctttttgcggcccccctcgtgatttcggccgccatgctgtcgtttgcgcatggg
gccaatgacgttgcaaatgcggtggggccattagcggccatcgtccacgctgctgaattt
ggcgacttttcgtcgaaggttgaaattcccctctgggttatggtgattggggcgcttggc
atttcgtttggtcttgtgctgtttggtccaaaactcatccgcatggtgggcagccagatc
accaagctcaacccgatgcgcgcctattgcgtcgccctttccgctgcggtgaccgtaatt
atcgccagctggttgggcctgcctgtgagttcaacgcatatcgcaattggcggtattttc
ggcgttggattctatcgagaatggagtacggaacgtcgccttgccaagagccgcgaaacg
cgtgcaccagagaagcgcatcgcggttgaggagcggcgtcgacgcaaattggtgcggcgc
agccactttatgacaatcatcgcggcatgggtgatcaccgtgcccgctgccgcgataatg
tcggctgggattttctacttcctcaacttcgtcattggctaa

DBGET integrated database retrieval system