KEGG   Halocynthiibacter arcticus: RC74_02275Help
Entry
RC74_02275        CDS       T04275                                 

Definition
(GenBank) phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
hat  Halocynthiibacter arcticus
Pathway
hat00030  Pentose phosphate pathway
hat00480  Glutathione metabolism
hat01100  Metabolic pathways
hat01110  Biosynthesis of secondary metabolites
hat01120  Microbial metabolism in diverse environments
hat01130  Biosynthesis of antibiotics
hat01200  Carbon metabolism
Module
hat_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hat_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RC74_02275
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RC74_02275
Enzymes [BR:hat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     RC74_02275
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     RC74_02275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored IlvN Shikimate_DH ApbA 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AML50248
UniProt: A0A126UVZ7
Position
complement(459255..460679)
Genome map
AA seq 474 aa AA seqDB search
MSDNGDKAAIGLIGLGTMGSALALNIADNGYKIAVTNRTVSRVAEFTRDAGDLAKNLVGC
DDIASFVASLETPRAIILMVPAGQAFDDQIEALKPFLDQGDTIIDAGNTNFHDTRRRDAA
LAAEGFRFIGMGVSGGEEGARFGPSIMVGGPVESFTPIEPIIMAIAAKYQGDPCAAHLGP
DGAGHFVKTVHNGIEYADMQLIAEVWGILRDGQGKSAAEAGALFDRWNEGDLKSYLVEIT
GKALGSVDAETGKAMVDIILDRAGQKGTGRWTVIEALGLGQSASTIEAAVGARSWSAVKD
VREAGAEILKVTPEGGASVSEEDLAEALLAARILAYAQGFDILTAASETYKWDLDMARVA
EIWRAGCIIRSALLDDISAAFRGDMPKGRLILAPAFAKRLIAGSAALRRVVASAAMNGQP
TPAFSAALAYFDTMRQARGTTDLVQAQRDFFGAHGFERVDQPGAHHGPWAMNPK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcggataatggggataaggctgcaatcggcctgattggacttggcacaatgggcagc
gcgcttgcgctcaacatcgcggacaatggctataaaatcgcggtgacgaaccgcacagtt
tcccgcgtcgcggaatttacgcgcgacgccggagatttggctaaaaaccttgttggatgt
gatgatatcgcaagcttcgtcgcctccctcgaaacgccccgcgcgatcattttgatggtg
cccgcagggcaagcttttgatgatcaaattgaggccttgaagccttttcttgaccaaggc
gacaccatcattgacgctggcaacaccaatttccacgacacccgtcgccgcgacgccgcc
cttgccgccgaagggttccgcttcattggcatgggcgtttctggtggtgaagagggcgcg
cgtttcggcccgtccatcatggtcggtggccccgttgaaagcttcaccccgattgagccg
atcatcatggcaatcgccgcgaaatatcaaggcgacccctgtgccgcgcatcttggcccc
gatggcgcgggtcactttgtaaaaaccgttcacaacggtatcgaatatgccgacatgcaa
ttgatcgccgaagtttggggtattctgcgcgatggtcaggggaaatccgcggccgaagcg
ggtgccttgttcgaccgctggaacgagggtgatctcaagagctacctcgttgaaatcaca
ggtaaagcactgggttccgtcgacgctgaaaccggcaaagcgatggtcgacattatcctc
gaccgtgctgggcaaaagggcacgggccgttggacggtgatcgaagcccttggccttgga
cagtccgcctccacgattgaggccgccgtcggcgcacgcagttggtctgcggtcaaagac
gtgcgtgaagcgggagctgaaatcctgaaagttacccctgaaggcggcgcatctgtaagc
gaagaagacctcgccgaggcactccttgccgcgcgaattttggcctatgcacagggcttt
gacattctaacggctgcgtctgaaacctataaatgggacttggatatggcgcgggtcgcc
gaaatttggcgcgcaggatgtatcattcgttcagctctgcttgatgatatttcggccgcc
ttccgcggtgacatgcccaaaggtcgcttgatccttgcgcctgcctttgccaaacgcctg
atcgcaggttctgcggcattgcgccgtgtggttgcctccgctgcgatgaacggccagcca
acccctgcgttctccgccgctttggcctatttcgacacgatgcgccaagcgcgcggcacc
accgatttggtgcaagcgcaacgcgatttctttggggcgcatgggtttgaacgggttgat
caacccggcgctcatcacgggccatgggcgatgaaccctaagtaa

DBGET integrated database retrieval system