KEGG   Halocynthiibacter arcticus: RC74_04255Help
Entry
RC74_04255        CDS       T04275                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hat  Halocynthiibacter arcticus
Pathway
hat03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hat00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    RC74_04255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hat03011]
    RC74_04255
Ribosome [BR:hat03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    RC74_04255
  Bacteria
    RC74_04255
  Archaea
    RC74_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 B12-binding
Motif
Other DBs
NCBI-ProteinID: AML50591
UniProt: A0A126UX09
Position
complement(850247..850627)
Genome map
AA seq 126 aa AA seqDB search
MAKVKNARRVAENEAMAKVKMLRTSPIKLNLVAAMIRGKKVDKALTDLTFSNKRIAADVK
KCLQSAIANAENNHNLDVDSLIVAEAYVGKNLTLKRGRPRARGRFGKILKPFSELTILVR
QNEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtaaaaaacgcacgccgcgtagcggaaaacgaagcaatggcgaaagtcaaa
atgctccggacctcccctatcaagctgaaccttgttgcggcgatgatccgtggcaagaaa
gttgacaaggctttgacagacctgaccttcagcaacaaacgtattgctgctgacgttaag
aaatgtctccagtccgcgatcgctaacgcagaaaacaaccacaatctggatgttgactcg
ttgatcgttgccgaagcctatgttggtaaaaacctgacacttaaacgtggtcgtccacgc
gcacgtggccggttcggcaaaattctgaagccattctcggaactaacaatcttggttcgc
cagaatgaggagcaagcataa

DBGET integrated database retrieval system