KEGG   Halocynthiibacter arcticus: RC74_08420Help
Entry
RC74_08420        CDS       T04275                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hat  Halocynthiibacter arcticus
Pathway
hat00071  Fatty acid degradation
hat00072  Synthesis and degradation of ketone bodies
hat00280  Valine, leucine and isoleucine degradation
hat00310  Lysine degradation
hat00362  Benzoate degradation
hat00380  Tryptophan metabolism
hat00620  Pyruvate metabolism
hat00630  Glyoxylate and dicarboxylate metabolism
hat00640  Propanoate metabolism
hat00650  Butanoate metabolism
hat00900  Terpenoid backbone biosynthesis
hat01100  Metabolic pathways
hat01110  Biosynthesis of secondary metabolites
hat01120  Microbial metabolism in diverse environments
hat01130  Biosynthesis of antibiotics
hat01200  Carbon metabolism
hat01212  Fatty acid metabolism
hat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RC74_08420
   00630 Glyoxylate and dicarboxylate metabolism
    RC74_08420
   00640 Propanoate metabolism
    RC74_08420
   00650 Butanoate metabolism
    RC74_08420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RC74_08420
   00072 Synthesis and degradation of ketone bodies
    RC74_08420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RC74_08420
   00310 Lysine degradation
    RC74_08420
   00380 Tryptophan metabolism
    RC74_08420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RC74_08420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RC74_08420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RC74_08420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hat04147]
    RC74_08420
Enzymes [BR:hat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RC74_08420
Exosome [BR:hat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC74_08420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Chalcone_2
Motif
Other DBs
NCBI-ProteinID: AML51270
UniProt: A0A126UYZ5
Position
complement(1697446..1698621)
Genome map
AA seq 391 aa AA seqDB search
MTHVVIASAARTAVGSFNGSFANTPAHDLGAAVLECLVERAGIDKAEVSETILGQVLTAG
QGQNPARQAHINAGLPKEAAAWGINQVCGSGLRAVALGTQHILLGDAEIVTAGGQENMSM
SPHVANLRQGHKMGDMQFIDSMIRDGLWDAFNNYHMGTTAENVAKQWDITREMQDLFAVG
SQNKAEAAQKAGKFVDEIMPFIVKSRRGDTVVDADEYIRHGVTMEAMQKLRPAFDREGTV
TAANASGLNDGAAGALLMSAANAEKRGIEPLGRIASYATAGLDPSIMGVGPVYASKKALE
KAGWKASDLDLIEANEAFAAQACAVNKEMGWDPEIVNVNGGAIAIGHPIGASGARVLNTL
LFEMKRRDAKKGLVTLCIGGGMGVALCVERD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgttgtcatcgcatctgcagcgcgaaccgctgtgggcagctttaatggttcg
tttgccaacacccccgcccacgacctcggcgccgctgtgctcgaatgtcttgttgagcgc
gccggaattgacaaagccgaagtttcagaaaccatccttgggcaagttttaacggccggc
caagggcaaaacccagctcgccaagcgcatataaacgcgggccttccaaaagaagcggcc
gcttggggaattaaccaagtttgcggatctggcctgcgtgccgttgctttgggaacacag
catattttactgggcgacgccgagattgtcaccgctggtggtcaagaaaacatgtccatg
tccccccatgtcgcaaacctgcgtcagggacacaaaatgggcgacatgcagttcattgac
tcgatgatccgcgacggcctgtgggatgcatttaataattaccacatgggtacaaccgca
gaaaacgttgcaaaacagtgggacatcacccgcgaaatgcaggacctctttgcggttggc
agccaaaacaaagctgaagccgcacagaaggctggcaagtttgtcgatgaaatcatgccc
tttatcgtaaaatcacggcgcggtgataccgtggtcgacgcggatgaatacattcgtcat
ggcgtaacaatggaagcgatgcaaaaattgcgccccgcatttgatcgtgaaggcacagtc
accgcggccaacgcttctggcctcaacgacggtgccgccggagcgcttcttatgagcgcc
gcgaatgcagaaaaacggggaatcgaacctttaggccgcattgcaagctacgcaacagct
ggtctcgacccctcaattatgggcgttggacccgtttacgccagcaagaaggccctcgaa
aaagctggctggaaagcaagcgatttggacttgattgaggccaatgaagctttcgcagca
caagcctgtgccgttaacaaagagatgggctgggatcctgagatcgtgaatgtaaacggc
ggtgcgatcgccattggccacccaatcggtgcttctggcgcgcgtgtgctaaacactctt
ctgttcgaaatgaagcgccgcgacgcgaaaaagggtctggtgacactttgtattggcggt
ggaatgggcgttgcactttgtgttgaacgcgactaa

DBGET integrated database retrieval system