KEGG   Halocynthiibacter arcticus: RC74_09540Help
Entry
RC74_09540        CDS       T04275                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
hat  Halocynthiibacter arcticus
Pathway
hat00270  Cysteine and methionine metabolism
hat00480  Glutathione metabolism
hat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RC74_09540
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RC74_09540
Enzymes [BR:hat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     RC74_09540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3 GSP_synth
Motif
Other DBs
NCBI-ProteinID: AML51467
UniProt: A0A126UZZ4
Position
1922045..1922986
Genome map
AA seq 313 aa AA seqDB search
MALKIAFQMDPIEHFDISGDSSFRLAEEAQARGHKLFYYTPDKLAYQEGKITARGWPLKV
QRVVGDHYSLGEETEVDLADFDVVWLRQDPPFDMGYITTTHLLDRLKATTLVVNDPFWVR
NYPEKLLVLDFPDLTPPTTIARDLATIRAFKERHKDVILKPLYGNGGAGVFRLDANDRNL
ASLHELFSGINREPLIVQKFLPDVSNGDKRVILVDGVPVGAINRVPAAGETRSNMHVGGR
PEKIGLTARDLEICDAIGPLLREKGQIFVGIDIIGDYLTEINVTSPTGILELEKFDGGNI
AAQVWEAIEAKCR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcacttaaaatcgcgtttcaaatggacccaatcgagcatttcgatatttctggggac
agttcttttcggcttgcagaagaagcgcaagcgcgcgggcataagttgttttactacacg
ccggacaaactcgcctaccaagagggtaaaatcacagcgcggggttggcctctcaaggtt
cagcgtgtcgttggcgaccattattctttgggtgaagaaacagaagttgatcttgctgat
ttcgatgtggtctggttgcgtcaggaccctccgtttgacatgggctacatcacaacaacg
catcttttggatcgcctcaaagcgaccacccttgtggtaaatgacccgttttgggtgcgg
aattatcccgaaaaactattagttttggatttccccgatttgactccgccaaccacaatc
gcgcgcgacttggccacgatacgcgcctttaaagagcgccacaaagacgtgattcttaag
ccgctttatggaaatggcggggcgggcgtattccggttggatgcaaatgatcgaaacttg
gcttccctgcatgagttgttttcgggcattaatcgcgagccgctgatcgttcaaaagttt
ctacccgatgtttcaaatggcgataaacgcgtgattttggttgatggggttcctgttgga
gccatcaaccgcgttcctgcggcgggagaaacacggtcgaatatgcatgttggcgggcgg
cccgagaaaattggcctgaccgcgcgggatttggaaatttgtgatgccatcggaccgttg
ttgcgtgaaaaaggccagattttcgtaggaatcgatattatcggcgactatctcaccgaa
attaacgtgacctccccaacgggcatcctcgagttggagaaattcgatggtggaaatatt
gcggcgcaagtttgggaagctattgaagctaagtgccgttaa

DBGET integrated database retrieval system