KEGG   Halocynthiibacter arcticus: RC74_13045Help
Entry
RC74_13045        CDS       T04275                                 

Definition
(GenBank) 6-aminohexanoate hydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
hat  Halocynthiibacter arcticus
Pathway
hat00330  Arginine and proline metabolism
hat00360  Phenylalanine metabolism
hat00380  Tryptophan metabolism
hat00627  Aminobenzoate degradation
hat00643  Styrene degradation
hat01100  Metabolic pathways
hat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    RC74_13045
   00360 Phenylalanine metabolism
    RC74_13045
   00380 Tryptophan metabolism
    RC74_13045
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RC74_13045
   00643 Styrene degradation
    RC74_13045
Enzymes [BR:hat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     RC74_13045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AML52077
UniProt: A0A126V1M6
Position
complement(2635268..2636695)
Genome map
AA seq 475 aa AA seqDB search
MTTNNPDDATSLAQLIASGAASPSELLDDALARVKAVNPALNAVVLLQEDVARRSIRDGL
PDGPFKGVPFLIKDLGAESVDFPSHNGSIPLSDTRYTYDSEIYRRMRATGVVTFGRTTSP
EGGIGPVTEAAVYDGPTRNPWDVSRTSGGSSGGAGAAVAAGIVPLAHGSDGGGSVRIPAS
SSGLFGFKATRARFPDGPAAGEGWAGMAIDGFLSRSVRDNATMMDACAGPDAGAPYAAPA
MEISYSAAIARPPRRLRIGICDTTFTGAAIHPDCKAAVAAAAKLLESLGHTVVPACPKAD
HNGMMRAWTKIVACGTALSARGLRERQKDLQGVSKSAIRYAQDISGADYLKAVGDIHSYG
RQMAAAFADYDILLSATLAEPPAKVGRFTHERDDYEAYRIGEGGVFSYSPFCAAFNASGQ
PAASVPLHWNDEGLPIGIHLAAPFGEDATLIALCAECEQAQPWALRKPPVWCGKP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaacaacccagacgacgcaacctccttggcgcaattaatcgcgtctggtgcg
gcatcaccaagtgaacttttggacgacgctctcgcgcgggtaaaggctgtaaatccggcg
ctgaatgctgtggtgctcctgcaagaagacgtcgctcgacgttcaattcgcgatgggctt
cctgacggccctttcaaaggcgtgccgtttctaatcaaagacttgggcgcagagtcggtt
gattttccgtcccacaacgggtcaatcccgctgagcgatacgcgttatacgtatgactcc
gaaatctatcggcgtatgcgcgccactggggtcgtgacctttgggcgaaccacgtcgcca
gaaggaggcattggccccgtcaccgaagccgccgtttatgatggcccaacgcgaaacccc
tgggatgtttcgcgcacctcgggaggatcttcgggtggtgctggggcggcggttgctgcg
ggcatcgtccccttggcgcatgggtctgacgggggaggctcagtgcgtattccggcctca
agttctggattatttggcttcaaggcaacccgcgctcggtttcccgatggacctgctgct
ggtgaaggctgggcaggcatggcaatcgatgggtttttgtcacgttccgtgcgcgacaac
gccacgatgatggatgcctgtgctggccctgacgcgggggcgccctatgctgcgcccgcg
atggagataagctattccgcagcaatcgcccgtccaccgcgccgcctgcgtattggtatc
tgtgacacaacatttacaggcgcagcaatccatcccgactgcaaggcagcggtggcggct
gcggccaaacttttggaatcgcttggacataccgtggtgcctgcgtgcccaaaggccgac
cataacgggatgatgcgggcttggaccaaaattgtggcctgtggaacagccctttcggca
cggggcttgcgggaacgtcagaaagacttgcaaggggtctccaaaagcgccatccgctac
gcgcaagacatcagcggcgctgattatctgaaggccgtgggggatatccacagctatggc
cgacagatggccgccgcatttgcagattacgacatcctgttgtcggcgacccttgccgag
ccccccgcaaaggtcggacggttcactcatgagcgcgacgattatgaggcctatcgcatc
ggcgaagggggggtgttttcctattcgccgttttgcgccgcgttcaacgccagcggacaa
ccggcggcatctgtccctttgcattggaacgatgagggtttgccaatcggcatccacctt
gcggccccctttggcgaggatgccacattgatcgcgctctgtgcggaatgcgagcaggcg
caaccttgggccctgcgcaaaccacccgtatggtgcggaaaaccttga

DBGET integrated database retrieval system