KEGG   Halocynthiibacter arcticus: RC74_15790Help
Entry
RC74_15790        CDS       T04275                                 

Definition
(GenBank) amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
hat  Halocynthiibacter arcticus
Pathway
hat00350  Tyrosine metabolism
hat00360  Phenylalanine metabolism
hat00380  Tryptophan metabolism
hat01100  Metabolic pathways
hat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RC74_15790
   00360 Phenylalanine metabolism
    RC74_15790
   00380 Tryptophan metabolism
    RC74_15790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hat04147]
    RC74_15790
Enzymes [BR:hat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     RC74_15790
    4.1.1.105  L-tryptophan decarboxylase
     RC74_15790
Exosome [BR:hat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC74_15790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Aminotran_1_2 MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AML52538
UniProt: A0A126V2I4
Position
complement(3198697..3200079)
Genome map
AA seq 460 aa AA seqDB search
MNHDDLAHWSKIAADWARDYHAGLRDVPVRPNIKPGSIASQLPAKAPDAPEDMSTIFADF
ERLVPSNTTHWQHPRFFAYFPANASPASMLAEQLANAIAGQAMLWQTAPAANEIEAVMIG
WLANAMGLPDTFTGTIHDSATTTTLSAVLTMRERALDWAGLTDGLSGQPRLRIYASAQTH
SSVDKAVRVAGIGQNNLVKIPTTSDYGMDPAALDAAIRADIAAGHLPAGVVLCTGGTSIG
ACDPIDACIKVAKAHNLFVHVDAAWAGSAMICEEFRPLWEGIEGADSIVFNPHKWLGVQF
DCAIQFMPDPSEQIRTLGLRPAYLNTQGQDEIVNYNEWTVPLGRRFRALKIWFTLRAYGL
DGLRERIRNHVAWSLEARDAIALIPGCLLTTSPRLSLFTFSYIDDVETAALLERINADGR
IYLTQTTHDERFVIRVQVGQFDCTRDDVMMIPTVIRDLIA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgatgatctggcccattggtcaaaaatcgccgccgattgggcgcgcgactat
cacgcgggtctgcgcgacgtccctgttcgcccaaatatcaaaccaggctcaatcgcctcg
caactccccgccaaggcccccgacgcacccgaggatatgagcacaattttcgcggatttc
gaacgcctcgtgcccagcaacacaacccactggcaacacccgcgtttctttgcctatttc
cccgccaatgcttcacccgcttccatgcttgcagagcaactcgctaacgccatcgcgggc
caagccatgctctggcaaaccgcccccgccgccaatgaaatcgaggccgtgatgatcggc
tggctcgccaatgcgatgggcctgcccgacacgttcaccggcacaattcacgacagcgcc
accacgacaaccctatcggctgtgctcaccatgcgcgaacgtgcgctagattgggcgggc
ctcaccgacggcctgagcggccaaccccgcttgcgcatttacgcctccgcccaaacccac
agttccgttgacaaggccgtgcgggtggcgggcatcggccaaaacaacctcgtcaaaatc
cctacaacttctgattacggcatggaccccgcggcgcttgacgcggccattcgcgcagac
atcgcggcgggccacctccccgcgggcgtcgtcctctgcacaggcggcacatccattggt
gcttgtgatccgattgatgcctgtatcaaagtcgccaaagcccacaacctcttcgtacat
gtggacgccgcatgggccggaagtgcgatgatctgcgaggaattccgccccctttgggag
gggattgaaggcgcggattccatcgtattcaacccacacaaatggctcggggtccaattc
gattgcgccatccagttcatgcccgacccaagtgagcaaatccgcacactcggcctgcgc
cccgcctatctcaacacccaaggccaagacgaaatcgttaattacaacgaatggacggtc
cccttgggccgccgtttccgcgcactcaaaatctggtttaccctacgggcctatggctta
gatggcttgcgcgaacgcatccgaaaccacgtcgcatggtcgcttgaggcccgcgacgcg
atcgcgttgatccccggttgcctcctcacaacctcgccgcggctgtcccttttcaccttt
tcctatatcgatgacgtcgaaacagccgccttactcgaacgcatcaacgcggacgggcgg
atttatttgacccaaaccacccacgacgagcgctttgtaatccgtgtccaagtcgggcaa
ttcgactgcacgcgcgacgacgtgatgatgatccccaccgtcatccgtgatctcattgct
tga

DBGET integrated database retrieval system