KEGG   Herpetosiphon aurantiacus: Haur_0390Help
Entry
Haur_0390         CDS       T00614                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00860  Porphyrin and chlorophyll metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Haur_0390
Enzymes [BR:hau01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Haur_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase MCM AAA_5 AAA AAA_16 AAA_22 TsaE RuvB_N ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: ABX03041
UniProt: A9AUC2
Position
complement(460034..461065)
Genome map
AA seq 343 aa AA seqDB search
MNELLPYPLLGIVGQRELKTALTLALVNPAVGGVLLSGPYGVGKTTAVRGLLDIMPLVKR
SRCENNCPPDDESDLCPTCLDFLARGESRLKDDLMRLIELPLNARLEDVVGGLNERVAIE
QQRVVLEEGVLARANHNLLYVDEINLLDHAVVDAILDAAAQGQTFVRRGAMVKLYQSRLI
LIGSMNPEEGRLRPQILDRLGLRVWVGPLPNARERLEIYRRAIAFRQDRTAFRMAYAQAT
TQLRLDVLKARELLPKVHLTKTAERYAMQVITQLAIPSHRAEIVLLEAARARAAADDRVR
ATPNDIKAVAPMALRWRQSPHLSDFLQQHETDEHLIAQALQTQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcttttgccctatccattgctcggaattgtcggccagcgtgagcttaaaaca
gcgcttaccttggccttggtcaatccagcggtgggtggggttttgttaagtggcccctat
ggcgttggcaaaaccaccgccgtgcgtggcttgctcgatattatgcccttggtcaaacgg
tcgcgctgcgagaataattgcccccctgatgacgagagcgacctttgcccaacctgcctt
gattttttggcacgcggtgagtcacggctcaaagatgatctgatgcgcttgatcgagctg
ccgctcaatgctcggctagaggatgtggttggtggtttaaacgagcgggtcgcaatcgaa
caacagcgggtggtgctcgaagaaggggttttggcgcgggcaaatcataatttgctgtat
gttgatgagattaatttgcttgatcacgccgtcgtcgatgcgattctcgatgctgcggcg
caaggccaaacctttgtgcgccgtggggcaatggtcaagctttatcagagtcgcttgatc
ttaattggctcaatgaatcccgaagagggtcggctgcgcccgcaaattttggatcggttg
ggcttgcgggtttgggttgggccactgccaaatgcccgcgaacgcttagaaatttatcgt
cgcgcgatcgcctttcgccaagatcgcacagcttttcgcatggcctacgcccaagcaacc
actcaattacgcctcgatgtgctcaaagctcgtgaattgttgcctaaagttcatttaacc
aaaactgctgaacgctatgccatgcaggtcattacccaattggcaatcccttcacatcgt
gcggaaattgtgttgcttgaggcggcgcgagcacgggcggcggctgatgatcgggttcgt
gctacccccaacgatatcaaagcggtcgcgcccatggccttgcgctggcgacaaagcccg
catttgagcgattttttgcagcaacatgaaactgatgagcacttaatcgctcaagctttg
caaactcaataa

DBGET integrated database retrieval system