KEGG   Herpetosiphon aurantiacus: Haur_2208Help
Entry
Haur_2208         CDS       T00614                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
hau  Herpetosiphon aurantiacus
Brite
KEGG Orthology (KO) [BR:hau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Haur_2208
Enzymes [BR:hau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Haur_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP_C PHP
Motif
Other DBs
NCBI-ProteinID: ABX04848
UniProt: A9AX40
Position
complement(2807152..2808030)
Genome map
AA seq 292 aa AA seqDB search
MTLVKRSTTNLVLAADAAIDLQLHTTASDGQWSALNLIHHLKREGFGLAAITDHDRPDMA
QSMQDLAVAEGMPLLVATEMSCLWREQLVDLLCFGFELGPNPLMAIAAELYQRQQAIIAK
AFAYCCDQGYLTQQHQAQIVEILAQPSAQQPHLLAALVKQQNPTLAPAQFSQLIQASGCD
FATNPIAAVVAAAQQSGAICILAHPGRSDGFVCFDQALLDALRAEVPLDGIEADYPLHTA
EQAALYRSYAQQHKLLISAGSDSHSPNKPPIRYRAADYQALLERLGIIVQAD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgttaaacgttcaaccacaaacttggtgttagctgccgatgcagcgatcgac
ttacaattgcatacaacggccagtgatggccagtggtcagcacttaatctgattcaccat
ttgaagcgtgaaggctttggcttggccgcaattaccgaccatgatcggcctgatatggcg
caatcaatgcaggatttggcggtggctgaaggtatgcccttgttggtagcgactgaaatg
agctgtctttggcgcgaacagctggtcgatttgctgtgttttggctttgagcttgggcca
aatccactcatggcgattgccgctgagctgtatcaacgccagcaagcaatcatcgccaag
gcctttgcgtattgttgtgatcaaggctatttgacacagcaacaccaagcccaaattgtc
gagattctagcccaaccctcggctcaacaacctcatttattggcagccttggtcaagcaa
cagaacccaactcttgctccagctcaattttcgcaactgatacaagcctcaggctgcgat
tttgcaactaatccgattgctgcggttgtggcagcggcgcagcagagtggggcaatctgc
atcttggcccatccaggccgcagcgatggctttgtctgttttgatcaagcgctgctcgat
gcgttacgcgctgaagtacccttggatggaattgaggccgattatcccttacatactgct
gaacaagctgccttataccgtagctatgcccaacagcacaagcttctgatcagcgctggc
tccgattcgcatagccccaataaaccgccgattcgctatcgagctgctgattatcaagca
ttgttggaacgattggggattatagttcaagctgattga

DBGET integrated database retrieval system