KEGG   Herpetosiphon aurantiacus: Haur_4053Help
Entry
Haur_4053         CDS       T00614                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00790  Folate biosynthesis
hau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Haur_4053
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Haur_4053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ABX06685
UniProt: A9AVT5
Position
5171007..5171489
Genome map
AA seq 160 aa AA seqDB search
MTIVYLAIGSNQGDRLANLQAGLAALAPAVQLTNYSSVYETAAAYVEDQPPFLNAVVAGT
TELAPHALLALLKQIEHDCGRRPGLRYGPRPLDLDILLYGELELQTNDLIIPHLRMFERD
FVLRPLAEIAPNQVNAEQLAQATQGSVLAVVYSAKQLQGR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgtttatttagccatcggcagcaaccaaggcgatcgtttagccaacttacaa
gcgggcttagccgctttagctcccgctgtgcaactaaccaactactcaagcgtttatgaa
accgcagcggcctacgttgaagatcaaccgccgtttttgaatgcggtggttgctggcaca
accgaattagcgccacatgcgctgttagccttgctcaagcagatagagcacgattgtggc
cgccgacctggcttgcgttacggcccgcgcccgcttgatcttgatattttgttgtatggc
gagcttgaattgcaaaccaatgacttgattattccacatttgcggatgttcgagcgtgat
tttgtgttgcgacccttggccgaaatcgcccccaaccaggtcaatgctgagcaacttgcc
caagcaacccaaggcagcgttttagctgttgtctactcagccaagcaattacagggcaga
tga

DBGET integrated database retrieval system