KEGG   Herpetosiphon aurantiacus: Haur_4076Help
Entry
Haur_4076         CDS       T00614                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00010  Glycolysis / Gluconeogenesis
hau00020  Citrate cycle (TCA cycle)
hau00620  Pyruvate metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01130  Biosynthesis of antibiotics
hau01200  Carbon metabolism
Module
hau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_4076
   00020 Citrate cycle (TCA cycle)
    Haur_4076
   00620 Pyruvate metabolism
    Haur_4076
Enzymes [BR:hau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Haur_4076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ABX06708
UniProt: A9AWE9
Position
5202352..5203932
Genome map
AA seq 526 aa AA seqDB search
MTERAVLSEGDTVGANLHVKQAYRNLTVPQLVEAALKRGEAVLSATGAVVATTGARTGRS
ADDKFVVETPAAASMHWTKFHKAMKPETYATIKAKALAHMAEREMFVLDASAGADPAYAL
PIRVVTEYAWHNLFAKQLFRDAISSDQQPQWTVLNLPSLKLDPAVDGSRSEVAAMINLDE
KLILIVGTEYAGEIKKSIFTVLNMVLPSQGVMPMHCSANIGSKGDVALFFGLSGTGKTTL
SADPERILIGDDEHGWSANGVFNFEGGCYAKCIRLRRESEPEIFDAIRYGAVLENVVLSD
SRDPNYDDASLTENTRAAYPLEYIPNVSETGMGGQPETIIFLTADAFGVLPPIAKLSPEQ
AMYHFLSGYTAKLAGTETGVGSEPQATFSTCFGAPFMPLHPTVYADLLGQKMREHKVRVF
LVNTGWTGGSFGVGKRMSLRDTRTMVHAALAGKLDAVEMWHDERFNLDVPVAIEGVDNSV
LQPRQTWADASEYDRVADDLAARFRKNFEQYAERAGETVVNAGPQA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgagccgtattaagtgaaggcgacactgtaggcgctaatttacatgtcaag
caagcctatcgcaacttaacggtgccgcaattggtggaagctgctctcaaacggggcgaa
gccgttttatcggctactggggctgtcgttgccaccacgggcgcacgcacgggtcgttct
gcagatgataagtttgtggtggaaacaccagcagccgcgtcaatgcactggacgaaattc
cataaagctatgaagcccgaaacctatgccacgatcaaggccaaggcgttggcacacatg
gccgaacgtgagatgtttgttttagatgctagcgctggggctgatccagcgtatgcgttg
ccaattcgcgtggtgaccgagtatgcttggcataacttgttcgctaagcaattgttccgc
gatgcgatcagcagcgatcaacaaccgcaatggacggtgctcaacttgccaagtttgaag
cttgatccagcggttgatggctcgcgctcagaagttgccgccatgatcaatctcgatgaa
aaattgattttgattgtcggtactgaatacgctggcgagatcaagaaatcgatctttacg
gtattgaacatggtgctgccaagccaaggcgtgatgccaatgcactgttcagccaacatt
ggcagcaagggcgatgtagccttgttcttcgggctttcgggcacgggcaaaaccacgctc
tcagccgaccccgaacggattttgattggcgatgatgagcatggttggagcgccaacggc
gtgttcaactttgaaggcggctgctatgccaagtgtattcgcttgcgccgcgaatcggag
ccagaaattttcgacgcaattcgctatggggcggtgctcgaaaacgtggtgctcagcgat
agccgcgatcccaattatgatgatgcgtcgttgaccgaaaacacccgcgctgcctatccc
ttggaatacattcccaacgtcagcgaaacgggtatgggcggccaaccagaaacgatcatc
ttcttgaccgctgatgcctttggagttttgccgccaatcgccaaactcagccctgaacaa
gcgatgtatcacttcttgtcgggctataccgccaagctggctggcaccgaaacgggcgtt
ggctcagagccacaagcaacgtttagcacctgctttggcgcaccgtttatgcctttgcac
ccaactgtgtatgccgatttgcttggccaaaaaatgcgcgaacacaaagtccgtgtattt
ttggtcaacactggctggactggtggttcgttcggggttggcaagcgcatgagtttgcgc
gatacccgcacgatggtgcatgccgccttggctggcaaactcgatgctgtggaaatgtgg
cacgatgagcgtttcaatctcgatgtgcctgtggcaatcgaaggcgttgataacagtgtg
ctgcaaccccgccaaacttgggccgatgccagcgaatacgatcgggttgccgatgacttg
gccgcccgcttccgcaagaacttcgagcaatacgccgaacgcgctggcgaaaccgtggta
aacgccggcccacaagcgtag

DBGET integrated database retrieval system