KEGG   Herpetosiphon aurantiacus: Haur_4102Help
Entry
Haur_4102         CDS       T00614                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hau  Herpetosiphon aurantiacus
Pathway
hau00010  Glycolysis / Gluconeogenesis
hau00030  Pentose phosphate pathway
hau00051  Fructose and mannose metabolism
hau00052  Galactose metabolism
hau00680  Methane metabolism
hau01100  Metabolic pathways
hau01110  Biosynthesis of secondary metabolites
hau01120  Microbial metabolism in diverse environments
hau01130  Biosynthesis of antibiotics
hau01200  Carbon metabolism
hau01230  Biosynthesis of amino acids
hau03018  RNA degradation
Module
hau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Haur_4102
   00030 Pentose phosphate pathway
    Haur_4102
   00051 Fructose and mannose metabolism
    Haur_4102
   00052 Galactose metabolism
    Haur_4102
  Energy metabolism
   00680 Methane metabolism
    Haur_4102
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Haur_4102
Enzymes [BR:hau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Haur_4102
Protein phosphatases and associated proteins [BR:hau01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Haur_4102
Messenger RNA biogenesis [BR:hau03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Haur_4102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABX06734
UniProt: A9AWH5
Position
complement(5234608..5235603)
Genome map
AA seq 331 aa AA seqDB search
MHRIAVLTSGGDSPGMNPAIRAVTRTALHAGCEVFGVYRGYAGLIQNDMRRLEYKDVGGI
IQRGGTMLLTARSPEFMTPAGREKAMENLRWHGIEGLVVIGGDGSLRGAAALTAEHGLPT
ICLPGTIDNDMYGTDMSIGADTALNTVLEAIDKIKDTASSHQRAFIIETMGRHSGYLALM
GGLAGGAEAILIPEIPDTTIEDVVEVIKRSFRKGKTNCVIVAAEGAHLNAQTIQDQINQI
DAEESGFSFSFRTRATILGHIQRGGSPSAFDRTLATRLGSGAVEFLLSGKNGGLVGMQSR
KLTVTPYDEVLANPKVLDAKLYELSKILDRY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcattgccgttttaaccagtggtggcgactccccagggatgaatcccgcaatt
cgtgcagtcacgcggactgcactccatgcaggttgtgaagtgtttggcgtgtatcgaggc
tatgctggcctcattcaaaatgatatgcgtcggcttgaatataaagatgttggcggcatt
atccaacgtggtggcacaatgctgctcaccgcccgctcgcccgaatttatgactcccgct
ggccgtgaaaaagccatggagaatttgcgctggcatggcattgaaggcttggtggtaatt
ggcggcgatggttcgttgcgtggggccgctgccctaaccgccgaacatggcctgcccaca
atctgcttaccaggcacaatcgataacgatatgtatggcactgatatgagcattggtgct
gatacggcgctcaacacggtgctggaagcaatcgataaaattaaagataccgcttcatca
caccaacgcgcttttatcatcgaaaccatgggtcgtcactcaggctatttggccttgatg
ggcggcttggctggcggcgctgaggcaattctgattcccgaaattcccgataccacaatt
gaagatgtggttgaagtgatcaagcgttcgtttcgcaagggtaaaaccaactgcgtgatt
gtggcagccgaaggggcgcatttgaacgcccaaaccatccaagaccaaattaaccaaatc
gatgctgaggaaagcggttttagctttagcttccgcacgcgggccacaattttgggtcat
attcagcgtggcggttcgccctcggcctttgatcgtactttggcaacccggcttggttcg
ggcgcggtcgagtttttgctatcaggcaagaatggtggtttggttggcatgcaatcacgc
aaattaaccgtcacaccctatgatgaggtgctggcgaatcccaaagtgcttgatgccaag
ctctacgaactttcaaaaattcttgatcgctactaa

DBGET integrated database retrieval system