KEGG   Hafnia alvei: AT03_00710Help
Entry
AT03_00710        CDS       T03425                                 

Gene name
rnpA
Definition
(GenBank) ribonuclease P
  KO
K03536  ribonuclease P protein component [EC:3.1.26.5]
Organism
hav  Hafnia alvei
Brite
KEGG Orthology (KO) [BR:hav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hav03016]
    AT03_00710 (rnpA)
Enzymes [BR:hav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     AT03_00710 (rnpA)
Transfer RNA biogenesis [BR:hav03016]
 Prokaryotic type
  5'processing factors
   Ribonucrease P
    AT03_00710 (rnpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_P
Motif
Other DBs
NCBI-ProteinID: AIU71061
UniProt: A0A097QX74
Position
complement(155804..156130)
Genome map
AA seq 108 aa AA seqDB search
MLTPNHFNFVFQQPQRAGTPQITILGRMNTLGHPRIGLTVAKKYVKRAHERNRIKRLTRE
SFRLSQHSLPAMDFVVIAKKGVQELDNRALTEILEKLWRRHCRQARVS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
ttgttaactcccaatcatttcaatttcgtcttccagcaaccgcaacgagccggcactcct
caaattaccatactcggccgtatgaacacgctggggcatccccgcatcggtcttacagtc
gccaaaaaatatgtcaagcgtgcgcatgagcgtaaccggatcaaacgcctaacgcgtgag
agcttccgtttaagccaacattcgctgcctgccatggattttgtggtaattgctaaaaaa
ggggttcaggagctcgataatcgggcgctgacagagattttggaaaagttatggcgtcgt
cattgtcggcaagctcgcgtatcctaa

DBGET integrated database retrieval system