KEGG   Hafnia alvei: AT03_08680Help
Entry
AT03_08680        CDS       T03425                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
hav  Hafnia alvei
Pathway
hav00860  Porphyrin and chlorophyll metabolism
hav01100  Metabolic pathways
Module
hav_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AT03_08680
Enzymes [BR:hav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AT03_08680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AIU72460
UniProt: A0A097R177
Position
1892918..1894453
Genome map
AA seq 511 aa AA seqDB search
MSLSLMVQGTASDVGKSVLVAGFCRIFMQDGYRCKPFKSQNMALNSGITAQGDEMGRAQI
FQAQAAGVAPDVRMNPVLLKPTSDRKAQVIVMGKVACHMDAVEYHHYKPQLQQQIKTVYQ
QLASESDIMVLEGAGSPAEINLRDRDIVNMGMAEAAGAPVLLVADIDRGGVFASIYGTLA
LLKPEERARVIGVIINKFRGDIALLRPGLKQIETLTQVPVLGVLPWLSLDLEDEDGVALQ
VGKYSSAKEADLDVVVIQFPHIANFTDFNPLSVQPDVRLRYAVDPQEIMGADLIILPGSK
NTLGDLSWLRSRRLDRAIKKAHGSGTAVMGICGGYQMLGNQIFDEVESGLSHMCGLGLLD
VDTCFEPSKKTAQVAGVSSSHLNGLLAQCCDQPLTGYEIHMGVSTLGENARPFAHMQVKN
GQAETWLDGALNHDGSVAGSYLHGLFDQNLFTRSLLNQLRQKKGLAPLDGENFDYTRHKE
TQFDALASNMRVHLDIDRIYALMRQHQEPQH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttcgctgatggttcaaggcaccgcctccgacgtaggaaaaagtgttttagtc
gccggattttgccgtatttttatgcaggatggttatcgctgtaagcctttcaaatcacag
aatatggcgttgaactcagggatcaccgcgcagggcgatgaaatggggcgagcacagatt
tttcaggcgcaggcggcgggcgttgcgcccgatgtgcgtatgaatccggtgctgcttaag
ccaacgagcgatcgcaaggcgcaggttattgtgatgggaaaagtggcctgccatatggat
gccgtggaatatcaccattataaaccccagctacagcagcagattaaaaccgtctatcaa
cagctggcgagcgaatcggacatcatggtgctggaaggtgcaggcagcccggcagaaatt
aatctgcgcgatcgagatatcgtgaatatgggcatggccgaggccgctggtgcaccggta
ttgctggtggctgatatcgaccgcggcggggtatttgcttctatctatggcaccttagcg
ttgctcaaacctgaggaaagggcgcgtgtcattggcgtcatcatcaataaatttcgcggt
gatatcgcgctgttgcgccctggactcaagcagattgaaacgctgactcaggttcccgtt
ctcggcgttttgccttggctatcgctggatctggaggatgaagacggcgttgcgctgcag
gtcggaaaatactcatccgccaaagaagccgatctggacgtggtggtgattcagtttccg
catatcgccaacttcaccgattttaatccgctctcggtgcagccggatgtacgtctgcgc
tacgccgtcgatccacaggaaatcatgggcgcggatctgattattttgccgggcagtaaa
aatacgctcggcgatctgagctggttaagatcgcgcaggctggatcgcgcgattaaaaaa
gcccacggttcaggtaccgcagtcatggggatctgcggtggttatcaaatgctgggtaat
cagatcttcgatgaagtggaatccggcctgagtcacatgtgcggattaggcttgctggat
gtggatacctgttttgaaccgagtaaaaaaaccgcgcaggtggcgggcgtttcaagctca
cacctcaacggcctgctggctcagtgctgcgatcaacctctgacgggttatgagatccat
atgggagtttcaacgctgggtgaaaatgcccgcccgtttgcccatatgcaggttaagaat
ggtcaggcggaaacgtggctcgacggggcgctaaaccatgatggcagcgtagcgggcagc
tatttgcatggcctgtttgaccaaaatctgttcacccgatcattgctcaatcagctgcgg
cagaaaaaaggcctagcaccgctagacggtgaaaacttcgattacacgcgccacaaagag
acgcagtttgacgcgctggcatccaacatgcgcgtgcatttggatatcgatcgtatctac
gctttgatgcgccagcatcaggaaccacaacattga

DBGET integrated database retrieval system