KEGG   Hafnia alvei: AT03_14875Help
Entry
AT03_14875        CDS       T03425                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
hav  Hafnia alvei
Pathway
hav02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AT03_14875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hav02000]
    AT03_14875
Transporters [BR:hav02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    AT03_14875
   Histidine transporter
    AT03_14875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4027
Motif
Other DBs
NCBI-ProteinID: AIU73547
UniProt: A0A097R493
Position
complement(3218035..3218721)
Genome map
AA seq 228 aa AA seqDB search
MLQGYSQLILNGALVTLELAVSSVLLAVVIGLIGAAAKLSRSPVLATIFEGYTTLIRGVP
DLVLMLLIFYGLQMMLNQLTDLLGWSQFNIDPLVAGVITLGFIYGAYFTETFRGAFMAVP
KGQIEAATSLGFSSSKIFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLDDLVKAT
QIAGKGTWQPFYFAIVAGVIYLLFTTLSNGVLLLLEKRYSAGVRRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaggctactcccaactaattcttaatggtgccctcgttacgctggagctggcc
gtgagctcggtgctgcttgctgttgtaatcggtttaattggggccgccgccaagctctct
cgttcacccgttcttgcgacgatttttgaaggttataccacgttgattcgcggtgttccc
gatctggttttaatgctactgatcttctacggcctacagatgatgctaaatcagctgacc
gatttattgggttggtcgcagtttaatatcgatccgttggttgccggagtgatcacgctg
ggttttatctatggagcctattttaccgaaacttttcgcggcgcatttatggcggtgcca
aaaggtcagatagaagccgctacctctcttggtttttccagcagcaagattttccggcgt
attttgtttcctgcgatgatgagatatgccctgccggggattggtaataactggcaggtg
atcctcaaagccacggcgttggtttcattgcttggcttagatgatttggtcaaagccact
cagattgcaggcaagggaacttggcagccgttttacttcgctattgtggctggcgtgatc
tatttgctatttaccacgctgtctaacggtgtgctgttgctgcttgagaagcgttattcc
gcgggcgtgagaagggccgagctatga

DBGET integrated database retrieval system