KEGG   Hafnia alvei: AT03_17530Help
Entry
AT03_17530        CDS       T03425                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
hav  Hafnia alvei
Brite
KEGG Orthology (KO) [BR:hav00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hav03009]
    AT03_17530
Enzymes [BR:hav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     AT03_17530
Ribosome biogenesis [BR:hav03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AT03_17530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AIU74018
UniProt: A0A097R5M0
Position
complement(3806185..3807330)
Genome map
AA seq 381 aa AA seqDB search
MNKLALYCRPGFEKECAAEITEKAAALEVFGFPRVKENSGYVTFECYQHEDADKLAKNLP
FRELIFARQMIVVGELLKDLPTDDRVSPIVGMLMNVIDGAGELRVEVPDTNESKELMKFC
RKFTVPLRAALREQKILLKNENAHRPVVHVFFIAPGCCYVGYSYSNNNSPFYMGIPRLKF
PSDAPSRSTLKLEEALHVFIPHDEWDERLAGGMKAVDLGACPGGWTYQLVKRSMWVHSVD
NGPMAPSLMDTGQVTHHKADGFKFEPPHTNGVDWLVCDMVEKPAKVSSLVARWLVNGWCR
EAIFNLKLPMKKRYEEVSQNLSILAQTLKDNGINAQIAAKQLYHDREEITVHVRRMWGAI
PGRRDERELNRRMQLKNSNNS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagctttatattgccgcccaggattcgaaaaagaatgcgcagcagaaatt
accgagaaagccgcggctcttgaagtctttggcttcccaagagtcaaagaaaacagcggc
tatgtgacctttgaatgttatcagcatgaagatgccgataaactcgccaaaaatttgcca
ttccgcgagctgatttttgctcgtcagatgattgtagtgggtgagttgctcaaagattta
ccaactgacgatcgcgtttcgccgattgttggaatgctgatgaacgtgattgacggtgcc
ggtgaactgcgcgttgaggtgccggataccaatgaaagcaaagagctgatgaagttctgt
cgcaagttcacggtgccgctgcgcgctgcgttgcgtgagcaaaagatcctgctgaagaat
gaaaatgcgcaccgccctgtggtgcatgtgttctttattgcgccgggctgttgttatgtg
ggttattcctacagtaataacaactccccgttctatatggggatcccgcgtctgaaattc
ccatcggatgcgccaagccgttcaacgctgaagctagaagaagcgctgcatgtgtttatc
ccgcacgatgagtgggatgagcgtcttgctggcggtatgaaagcggtcgatttgggcgca
tgcccgggtggctggacttatcaattggtgaaacgcagcatgtgggtgcattcagtcgat
aacggtccaatggcacccagcttgatggataccggacaggttacacaccacaaagccgat
ggttttaaatttgagccaccgcacactaacggtgttgattggctggtatgtgacatggtt
gagaaacctgcgaaggtttcaagtttggtcgcgcgttggctcgtgaacggttggtgccgt
gaggcgatcttcaacctgaaactgccgatgaaaaagcgttatgaagaagtgagccagaac
ctatctattttggcgcaaacgctgaaagacaacggtattaatgctcagatcgcggctaaa
cagctttatcacgatcgtgaagaaatcacggtacacgtgcgtcgtatgtggggcgcgatc
cctggccgccgcgatgaacgtgagcttaaccgtcgtatgcagttgaagaatagtaataat
agctaa

DBGET integrated database retrieval system