KEGG   Hafnia alvei: AT03_18435
Entry
AT03_18435        CDS       T03425                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
hav  Hafnia alvei
Pathway
hav00230  Purine metabolism
hav01100  Metabolic pathways
hav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AT03_18435
Enzymes [BR:hav01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     AT03_18435
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AIU74179
UniProt: A0A097R623
Position
4010459..4012744
AA seq 761 aa
MSLGSPLKRVDAEAKVTGHARYTDDHQMHGMRYAKYVRSPLAHAYVTAIDTYAALALPGV
EAVFTYQDVPELRFPTAGHAWSLEPAKRDVADRQLLTQHVRHYGDGVAIVVARDALTAER
AAALVEVAYQELPVITTAQGALAPDAPLIHPEGNTLKKSDISANQPKEAISSADFQLSAH
FQTPVIQHCHMEGVTCFAYMEQPDHIVIVSSTQIPQIVRRTVAQTLGMPWSNIRVIKPYI
GGGFGNKQDVLEEPMAAFLTQKMGGIPVKVELSREECFFASRTRHAFSIDAELGLNHDGI
LTGYQLDVLSNTGAYASHGHSIASAGANKISYLYPRSAFGYSALTHYSNYPAAGAMRGYG
APQVAFALECLLDDAAEKLSLDAVDVRLLNAARSGDINPVNHKKIYSAGLVECLEKGRDL
FEWNARKAACQNQTGDLRRGVGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGATE
IGQGSDTVFAQMAAETLGIPFEHIRVISTQDTDITAYDPGAFASRQSYVAAPAVMQAASE
LRSKILAHAELISHQPQWGLTLLNGNVVMAAQPEMVLMSVAEVSMHAYYHQEIGAQLLAE
ISHKTTTNPPAFGCTFVDLSVDIPLCKVTINKIINLHDSGRILNPQLAEGQVHGGMGMGI
GWALFEEMIIDEKTGVVRNPNLLDYKFPTIMDLPDLDCAFVETYEPQSAYGHKALGEPPI
ISPAPAIRNAIRMATGIPINTLPITPKTLFAEFVQAGLIRE
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgtcgttaggatccccactcaagcgggtggacgctgaagctaaggttaccggccacgct
cgctataccgacgatcatcaaatgcatggcatgcgttacgccaaatatgtacgtagtcct
ctcgcccatgcttatgtcacggccattgatacttatgcggcactggctttgcccggcgtt
gaagccgtatttacttatcaagatgtgcctgaattacgattccccaccgcgggacatgct
tggtcactggaacccgctaaacgagacgttgccgatcgccagctactcacccaacatgtg
cggcattatggcgacggtgttgcgattgtggttgcgcgtgatgcgctaaccgcagaacgt
gccgccgcgctggttgaagtggcataccaagagctgccggtgataaccaccgcacagggc
gctttagcaccagacgcaccgctgattcatccagaaggcaatacgctgaaaaaaagtgat
atcagcgcgaatcagcctaaagaagcaatctcatcggctgattttcaactctctgcgcat
tttcaaacgccggtgatccagcactgccatatggaaggcgtgacctgttttgcctatatg
gaacagccagatcatatcgtgattgtctccagcacccagatcccgcagatcgtgcgccgt
accgtcgctcagacgctgggtatgccgtggtcaaacatacgcgtgatcaagccttatatt
ggtggtggattcggcaataaacaggacgtactcgaagagccgatggccgcatttctcacc
caaaagatgggtggcattccggtgaaggtcgaactcagccgtgaagagtgcttttttgct
tcccgcacgcgtcatgcctttagtatcgacgcggaactggggcttaatcacgacggtata
ttaacgggctatcagctggacgttctgtcgaacaccggcgcttatgcttcgcacggacat
tccatcgcttccgccggtgccaacaaaatcagctatctctatccccgtagcgccttcggc
tattctgccctcacgcattattcgaactaccccgccgcaggcgccatgcgcggctatggc
gcaccgcaggtggcttttgcacttgaatgtttattagatgacgcggcagaaaaactgtct
ctcgacgccgtcgatgtgcgtttgctgaatgcggcacgcagtggtgatatcaatccggtt
aaccacaaaaagatttatagcgcgggactcgttgaatgccttgagaaaggacgcgatctg
ttcgaatggaacgcccgtaaggccgcctgtcaaaatcaaacaggcgatctgcgccgcggt
gtcggcgtcgcatgttttagctacggttctaatacttaccccgttggcgttgaaattgcg
ggagcccgcatgttgctcaaccaagacggcacggtaaatctgcaaattggtgccacagag
atcggccaaggttcagataccgttttcgcccagatggccgccgaaacgctaggtattccc
tttgaacatattcgcgtgatatccacccaagataccgatatcactgcctacgaccccggc
gcatttgcgtctcgacagagctatgttgccgcaccggcggtaatgcaagcggcaagcgaa
ttacgcagtaaaatactggctcatgctgaattaattagccaccagccacagtggggactc
acgttactcaacggaaatgtggtgatggcggctcaacctgaaatggtactcatgagcgtg
gcggaggtttcgatgcatgcttattaccatcaggaaatcggtgcccagctgctggctgaa
atatcccataaaaccaccactaacccaccggcttttggctgcacgtttgtcgatctcagc
gtcgatattcctctatgcaaagtcaccatcaataagattatcaacctgcatgattcaggc
cgaattcttaacccacagctcgccgaaggccaagtgcatggcggaatgggcatggggatc
ggctgggctttatttgaagagatgatcattgatgaaaaaaccggcgtggtccgtaatcca
aacctgctggattataaattccccaccattatggatctgcccgatctggattgcgcattt
gttgaaacctatgaaccccagtctgcctacgggcacaaagcgctcggcgaaccgccaatt
atctcgcccgctcccgcgattagaaacgcgattcgtatggcaaccggcatccccattaac
acactgcccatcacgcctaaaacgctgtttgcggaattcgttcaggccggactcatcagg
gagtaa

DBGET integrated database retrieval system