KEGG   Hafnia alvei: AT03_18445
Entry
AT03_18445        CDS       T03425                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
hav  Hafnia alvei
Pathway
hav00230  Purine metabolism
hav01100  Metabolic pathways
hav01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AT03_18445
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AIU74181
UniProt: A0A097R626
Position
4013622..4014098
AA seq 158 aa
MNRKHWVDIECEINGKRYPFTISPALSLMELLRDEGLTSVKQGCGVGECGACTVLIDGVA
TDSCLYLAVWADGKRIRTAEGEVKNGRISQVQQAYVDAGAVQCGFCTPGLVMATTALLAK
HPSRPLTHEEIRRGLAGNLCRCTGYQMVIRAVKACCDN
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaaccgtaagcattgggttgatattgaatgtgaaattaacgggaagcgttaccccttt
acgatttctcccgcgctgtcgttgatggagcttctcagagatgaagggctaacgagcgtg
aagcagggctgtggcgtaggagaatgtggcgcctgcaccgtgcttatcgacggcgtcgcc
accgatagctgtttatatctcgccgtatgggccgatggaaaacgcatccgtaccgccgaa
ggtgaggtaaaaaatggccggatctctcaggtacagcaggcctacgtggatgccggtgcc
gtacagtgcggtttctgtacgccgggtctggtaatggcaaccacggcgctgctcgccaag
catccgtcccgcccgttaactcatgaagaaattcggcgtggattagctggaaacctctgc
cgctgcacgggctatcaaatggtgatccgtgcggttaaggcatgctgcgataactaa

DBGET integrated database retrieval system