KEGG   Helicoverpa armigera (cotton bollworm): 110370693Help
Entry
110370693         CDS       T05609                                 

Definition
(RefSeq) aldehyde dehydrogenase X, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00010  Glycolysis / Gluconeogenesis
haw00053  Ascorbate and aldarate metabolism
haw00071  Fatty acid degradation
haw00280  Valine, leucine and isoleucine degradation
haw00310  Lysine degradation
haw00330  Arginine and proline metabolism
haw00340  Histidine metabolism
haw00380  Tryptophan metabolism
haw00410  beta-Alanine metabolism
haw00561  Glycerolipid metabolism
haw00620  Pyruvate metabolism
haw00981  Insect hormone biosynthesis
haw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110370693
   00053 Ascorbate and aldarate metabolism
    110370693
   00620 Pyruvate metabolism
    110370693
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110370693
   00561 Glycerolipid metabolism
    110370693
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110370693
   00310 Lysine degradation
    110370693
   00330 Arginine and proline metabolism
    110370693
   00340 Histidine metabolism
    110370693
   00380 Tryptophan metabolism
    110370693
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110370693
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    110370693
Enzymes [BR:haw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110370693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110370693
NCBI-ProteinID: XP_021182274
Position
Unknown
AA seq 488 aa AA seqDB search
MVKVDIKYTKLFINNEWVDAVSKKTFPTINPQDESVITQVAEGDKADIDLAVAAAKKAFH
RYSEWRTLDASQRGRLLLKLADLMERDAAYLGQLETLDCGKPVKQAEGEVVWSAGIIRYY
AGKADKILGNTIPADGDVMTFTLKEPVGVCGQILPWNYPIPMFVWKIAPAFAAGCTVVVK
PAEQTPLTALAMAALVKEAGFPAGVLNVVPGYGPTAGHALTHHPDVDKVAFTGSTEVGRI
IMKAASAVNLKRVTLELGGKSALVVFNDADVDKAAEIAHRAAFANAGQCCVAGTRTYVQS
GIYDKFVAKAAEIAKNRTVGNPYTDVQQGPQIDTEMFTKVMGYIEAGKKGGARCVAGGER
QGNVGFFVKPTVFADVKDDMKIAREEIFGPVQSILKFETFEEVVDRANDSNYGLGAGVIT
NDITTALAFIKHVRAGSMWVNTYEVVTPQTPFGGFKESGIGREMGEDGILQYLENKTVSF
SLPKKPQL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagtagacatcaaatacactaagttgttcatcaacaatgagtgggtggacgct
gtcagcaagaagaccttccccaccatcaaccctcaggatgagtccgtcatcacacaagtg
gctgaaggcgacaaggctgacatagatttggctgtagccgcagccaagaaggctttccac
cgctactcagaatggcgtaccctcgacgcctcccaaaggggtcgcctcctcctcaagtta
gctgacctcatggagagagatgctgcgtacttgggacagctggagaccctggactgtggc
aagccagtcaagcaggctgaaggcgaagttgtctggtctgccggcatcatcagatattac
gctggaaaagccgacaaaatccttggcaacactattcccgcagacggtgacgtcatgacc
ttcaccttgaaggagcccgtgggcgtgtgcggacaaattctgccatggaactacccgatc
cccatgtttgtatggaaaatcgcccctgcttttgctgccggttgcaccgtcgtagtcaag
cccgcggaacagactcctctcacagcattagccatggctgccctggtcaaggaagccggt
ttccctgccggagtcctcaacgtggtccccgggtacggcccaacagccggacacgctctg
acccaccaccctgatgtcgacaaagttgcattcaccgggtccactgaggtgggtaggatc
attatgaaagctgcatcagccgtcaacttgaagcgagtcactcttgaacttggaggcaag
agcgctctggtggtcttcaatgatgctgacgtcgacaaggcagcagagattgcacatagg
gctgcgttcgccaacgctggtcagtgctgcgtcgctggtaccaggacttacgtccagtca
ggcatttacgacaagttcgtcgccaaagccgctgagatcgccaagaacaggactgttgga
aacccctacacagatgttcaacaaggaccccagatcgacacagagatgttcaccaaggtg
atgggttacatcgaggctggtaagaagggcggtgcccgctgcgtcgctggtggagaacgc
caaggaaacgtcggcttcttcgtcaagcccactgtcttcgctgatgttaaggatgatatg
aagattgctagggaggagatcttcgggcccgtccagagtatccttaagttcgagactttc
gaggaagtggttgaccgcgctaacgactccaactacggtctgggtgctggtgtcatcacc
aacgacatcaccacagccttggctttcatcaagcacgtgcgcgctggctccatgtgggtc
aacacctacgaagtcgtgactcctcaaactcccttcggtggattcaaggagtccggaatc
ggtcgtgaaatgggtgaggacggtatcctgcaatacttggagaacaagacagtttccttc
agcctccccaagaaaccccagctgtaa

DBGET integrated database retrieval system