KEGG   Helicoverpa armigera (cotton bollworm): 110370804Help
Entry
110370804         CDS       T05609                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00511  Other glycan degradation
haw00600  Sphingolipid metabolism
haw01100  Metabolic pathways
haw04142  Lysosome
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110370804
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    110370804
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110370804
Enzymes [BR:haw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     110370804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2 DUF229
Motif
Other DBs
NCBI-GeneID: 110370804
NCBI-ProteinID: XP_021182452
Position
Unknown
AA seq 525 aa AA seqDB search
MDLRAPCCTVIIIAIIAVIWITAAENADRPCMARATVNGSVCVCTAAYCDTVTRTVPLSG
SYVSYISSEAGLRFHKTIGKLYKHEKDETTEATIEIDVTTKYQSIEGFGGAVTDAAGINW
QNLTDPRLKRHLIQSYCSDQGLQYNMLRVPIGGSDFSTRGYAYNDLPEHDVNLANFTLEH
EDYEYKIPMIEACMEVATAPIEIIAATWSPPVWMKTNDEFSGNSRLHKKYMQTYADYHYK
FLEKYAEAGIPVWGLSITNEPLHSSINYIPANINSLGWNMDDMRDYIMENLGPTLRNNNS
MFKDVKIITGDDLRFTIILYWNMLILVYPETLQYLDGVAVHYYMNAYTPPTILSQAMENY
PGKFVISTEISAGAMPTDTVKVNLGAWDRAELYAGDIIENLSNNVIGYLDWNMCLNTDGG
PSWIDSSIDSAIIVNATAGEFYKNPMFYAMGHFSKFVPRGSRRVKTTVTNETSIQNIAFL
TPNDTVVVVIFNKGAEEKVRLRLGANEAELSIEAKSITTVEMPNE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggatctccgtgcgccctgctgtacagtgataattatagcaataatagccgtaatatgg
ataactgcggcagaaaacgcggaccgtccttgtatggcaagagctacggtcaatggatca
gtgtgtgtatgtactgcggcttactgcgacactgtcactagaacagtgcctcttagcggc
agttacgtttcctacatctcttctgaggcaggattacgatttcataaaactattgggaaa
ctctataaacatgaaaaagatgagaccacagaagctactatagaaatagatgtgacgact
aagtaccaaagtatagaaggtttcggaggtgctgtgaccgatgccgccgggatcaactgg
cagaacctgaccgacccgcgactcaagcgacatttaatacagtcttactgcagtgaccaa
ggtctgcaatacaacatgttgagggttcccatcggtggatccgacttctcgacgcgtggg
tacgcgtataatgacttgcctgaacacgacgtcaacttagccaactttactttggagcat
gaggattatgaatataagattcctatgatcgaggcgtgcatggaagtagctaccgcacca
atagaaataatagctgcgacttggtctccccccgtatggatgaagaccaatgacgagttc
tcaggcaacagccgacttcacaagaaatacatgcagacttacgcagactatcattataag
ttcttagaaaagtacgcggaggcaggtataccggtgtggggtttgagcataacgaatgag
cctctacacagcagcatcaactacatcccggcgaatataaacagcttgggttggaatatg
gatgacatgagagactacatcatggagaacttgggtcctacactccggaacaacaactct
atgttcaaagatgttaagatcatcaccggagatgatctgcgcttcaccatcattctctat
tggaatatgctgattctggtataccctgagaccctgcagtacctagatggcgttgcagtc
cactactacatgaacgcatacacaccgcccaccatcctctctcaggccatggagaactat
cccggcaagttcgtcatatccactgaaatcagtgcaggtgctatgccaacggataccgtc
aaagtaaatttaggagcgtgggatcgggctgagttatatgcaggagatatcatagagaat
ctcagcaacaacgtaataggctatctcgattggaacatgtgtctcaacacggatggtggt
ccgagttggatcgactcgtccatagactcggccatcatcgtgaacgcgactgcgggcgag
ttctacaaaaatcctatgttctacgcgatgggtcacttctccaagttcgttcccagaggc
tccaggagagtgaaaactactgttaccaacgagaccagtatacagaatatcgctttcctc
acccctaatgatactgtcgtcgttgttatttttaataaaggggctgaagaaaaagtcaga
ttgcgtttgggagcgaatgaagccgagttatcaattgaagccaaatctattacaaccgtc
gagatgcccaacgaatga

DBGET integrated database retrieval system