KEGG   Helicoverpa armigera (cotton bollworm): 110372636Help
Entry
110372636         CDS       T05609                                 

Definition
(RefSeq) uncharacterized protein LOC110372636 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:haw01001]
    110372636
   01009 Protein phosphatases and associated proteins [BR:haw01009]
    110372636
Enzymes [BR:haw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110372636
Protein kinases [BR:haw01001]
 Serine/threonine kinases: Other
  Wnk family
   110372636
Protein phosphatases and associated proteins [BR:haw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110372636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 110372636
NCBI-ProteinID: XP_021185162
Position
Unknown
AA seq 2464 aa AA seqDB search
MDNMASNVTLRSNKQRKDNLITRKQDKSPEKTIRGTRGAYRGIPSTSKRTEDENETGSTE
RLDRPKKFISQNKSNYGLGKRPDFSLKNRNVHLASSRYGQMTSGLHSHGHQISQPPGHHL
ESATVLPAKEKTVHGKEKTFKVVVGSEVGVMKAPLVGPRPYNALAIIHTQQSNTFDMLNS
LTTSVASQPVVGVGVGVGGFHRRSSGQGALCDPELDDSGNKLVARLEDDAFISEQDLEEN
IEIATATEKRISKTDASGEDQPQEPQNGLVYGPIYELEKLEQKDKQKEDKEDEEEPIGVS
PCGRFFKYDKEVGRGSFKTVYHGLDTQTGVAVAWCELLEKKLNKTERLRFREEADMLKKL
QHPNIVRFYNYWEGTVAKKKNIVLITELMLSGTLKAYLRRFKRINPKVLKSWCRQILKGL
NFLHSRTPPIIHRDLKCDNIFITGTTGSVKIGDLGLATLKNRSFAKSVIGTPEFMAPEMY
EEHYDESVDVYAFGMCMLEMATGEYPYSECSGPAQIYKKVVSGVKPQSLEKVTIPEVRDI
IESCIKPNKTDRPKVKDLLNHEFFGEDIGLRLEIVGRDLVTSSDITKIQFRLKIIDPKKR
SYTHKENEAIQFEYDMENDDCEEVANDMAKVGLIMEEDARIVTKLLKSQLISLNRERSEK
KAQMLFNQEVIIEQNRQQLYEQQLRQMKMIQNQQQAGPVDQVKAGLLNGVGPQPLAGVQL
DPQSQLLQCQQQLLHQQFQQLNNEDAAMKLLQQNFMQARISPSMATDQQILQNKVFLEQN
LKQQVMMEQNLINQQMLEQSVQGQVLMEQQVQQNLLEQTPSQAQLQPNLLNQQLTAEINN
QNQVLQQQIIQQQQTIIAQQAAAIQQKQFEEQLTAQDNMMSVPQNLVTGQMLDPSLQNLQ
NILAQIIQRPDTLQSRKESESETQSQQPQQQQQQQMTQQPNENLEMQQNQEQEALQQQMQ
NLIGSQRQQQNVNFHQSQQFAQPTLQQLAVDPTFLAQQQQVAQAQQQVAQAQQQLDMQKQ
VLTQQQLVLQQQIIGQQQLQMPGQTLSPQHFRHFQQQQQYLAQQELQLQTQQNIITQNWA
MLLQKQQLMDQQQQKVEEILRSQRPMYQRQGSEQSQISSADVHDQQQVMMPDQYGQKPQL
QQQMSVDQMHYNKQRSDDHYHQLTTMQGQSLPHNMQMQQNFSVVQQNERQISSHEGTPVQ
NYTANPLQMYQQAQSQPVQMMPNVYQSNQMESSIPSSVAASMPQQMPQPVQDPMPQMSVP
QSIPQSMSSVPQSMPQSVPQAVHAVPQPVHSVPQPMHSVPQTVQSIPQPVQSVPQPSTLS
HTIQQQPQPVQSIPQPVSNQVQQQIQPMQQQMQTLPSQVQQMPQPVQSLPQSLPPQPMQQ
LPQTQQMQMQQDLVQQPQQLNLPSEQVENGYQSNGGQKEQFHTPLTEFPNNHAEAIRQPE
LSSVEEKQGETQQQEAGTAISSPITGEKKSRGSKKRSREKDKLPKLTVLEVNEAATMVEC
QLESKSKTVTFKFDVTDVNPEEIASNLVSNNLLPEWQSATFMELIKDIVSQLLSNPGVTP
VLNPAHHSALRLNIDKTDYDSETTEREENLTDSNQDNSECTTPTASHDNIAAELAYDSAE
PEPAPAPAPAPAPAPAIPAHVDTVARKISTASSIGSNQSDGGSMAPERSGSTESQNGEKK
QSKPTRKISRFLVSPVVDRGENVPEDKPAPEPSEPKEPPKEPPKEPAKEPPREPQVNGLP
EKEVPPTLPPQEYVPTHQYSVPAQIQPPVDLRPEIQPVERPVERPVERPIEVPQEVPVTV
TMVPAPIVSNIQSIPQVPVQNIINPMLAASNLQPNLTTPLQIATDTPLLGLSQVGTPMGV
GGDLGLNMGLGQVGLGMSTQQTLTPTPGVTDAMPNAENIQRMLLKQNIMNQQQNLSGPNL
LGLLNQQPYPQPDLGLHNTILNNAQPAPMMAARLPPQYPQQKYYQPMLANDFIGLNPIFP
SSAQQQALQSSVNQLASQQMSQLNMMGLGPPLPPQALAFQHQNIAQNLALNQNLMGQNLG
QNLGNYTGLASQNLGLGGQNLIGGQNLALGGQNLALGGQNLGLINQNLGQLVAHRAVHHA
LARRAVDMDMAGMTNVNSTGSSQPSTPNKPHSYNEYMLNLQHKLASISNSGPVSPQSPLE
YSPALSPTHRPPLHNMPKVLSAEGGAAAETAPAHKSRHAAQLAELDHELSKISLHYKHAP
PKDVFIEHNAEEHEMLAATINDSAVNTYEAELGPEWESRSTRFRVSRAAPCRGYELCRLL
PGDHEKEKLDLLQSGSYGSGALDSVSCADNNSVCSEAGGDTYVITDTRAHAYLVHDALAG
TTTTIIHPGRAQHEQASPPSPPESEEDVCGAALVVETARALTCAVLDRALRLSPSEGFLP
FRDDKYAAHVQAEAGSVSAVEELSRWQGVAVAGDAVLCPARPQHAASLVTYETITDRGNA
TYLT
NT seq 7395 nt NT seq  +upstreamnt  +downstreamnt
atggacaatatggcgtcgaatgtgaccttgagaagcaataaacagaggaaagacaacctg
atcacgaggaagcaggataagtcccccgagaagacgatcagggggacgagaggggcgtac
agggggattccgtctacttcgaaaagaaccgaagatgagaacgagacgggctctacggaa
agactggatagaccaaagaaattcatatcacagaacaaaagcaactatgggttaggcaag
aggcccgacttctctctcaagaacaggaacgtgcatttagcttcgtctcggtatggacag
atgacatcagggctgcacagccacggacatcagatctcccagccgccaggacatcatctg
gagtcagccaccgtcctccccgctaaggagaagaccgtgcacgggaaagagaagaccttc
aaggtggtggtcggcagtgaagtgggcgtcatgaaggcaccgctagtgggcccccggccg
tacaacgctctcgccatcatacatacgcagcagagtaacacctttgatatgctgaattcg
ctcactactagtgttgctagtcaaccagtagtaggagtgggagttggcgtaggcggtttc
catcggcgcagttccggccagggtgctctctgcgaccctgagctggatgacagcggcaac
aagctggtggccaggctcgaagacgacgcctttatctccgaacaggatctggaagaaaac
atcgagatagcaacggcgacggagaagcgaatatcaaagactgatgcgtccggagaagat
cagccgcaagaaccgcagaatggcttggtgtacggtcctatctacgagctggagaagttg
gagcagaaagacaagcagaaggaggataaggaggacgaggaggaacccatcggagtatcg
ccttgtggcaggttcttcaagtacgacaaggaggtgggtcggggctcgttcaagactgtt
taccacggcctcgacacgcagaccggtgttgctgtcgcttggtgtgaactgttggagaaa
aagctaaacaaaacggagcgtctccggtttcgagaagaagctgacatgctgaagaagtta
cagcatcccaacatcgtgcggttctacaactactgggagggcacggtcgctaagaagaag
aatatcgtgcttattactgagcttatgcttagtgggactttgaaggcttatctccgaagg
ttcaagcgcatcaacccgaaagtgctgaagtcgtggtgtcgacagatattgaaggggttg
aattttctacactcgagaactccgcctattatacacagagatctgaagtgcgacaacatc
ttcatcacgggcacgacgggcagcgtcaagatcggagacctcggcctcgccacgctcaag
aacaggagcttcgccaagtctgtcataggcaccccggagttcatggcgccggagatgtac
gaggagcactacgacgagtcggtggacgtgtacgcgttcggcatgtgcatgctggagatg
gccacgggcgagtacccctacagcgagtgctccgggcccgcgcagatatacaagaaggtc
gtctcgggtgtaaaaccgcagagcttggagaaggtcaccatcccggaggtgcgagatatc
atcgagtcctgtatcaagcctaataaaacagacaggccgaaagtgaaagacctgctaaac
cacgagttcttcggcgaggacatcgggctccggctggagatcgtgggccgagacctcgtc
acctcctccgacatcaccaagatacagttccggttgaagatcatcgatcctaagaaacgg
tcctacacccacaaagagaacgaagcgatccaattcgagtacgacatggagaacgatgac
tgcgaggaggtcgccaacgacatggccaaggtcggcctcatcatggaggaggacgccagg
atcgtcaccaagctgctcaagtcacagctcatcagtcttaacagagagcgcagcgagaag
aaagcgcagatgctgttcaaccaggaagtgatcatcgaacagaacaggcagcagctttac
gagcagcagttaaggcagatgaagatgatacaaaaccagcagcaagcgggccccgtggac
caggtgaaggccggactcctcaacggagtcggaccccagcccctggcaggcgtacaacta
gacccgcaatcccagctcctgcaatgccagcagcaactgctgcaccagcagttccaacag
ctgaacaacgaggatgcagccatgaagctgctgcagcagaacttcatgcaggccaggatc
tccccctccatggccaccgaccagcagatcttgcagaataaggtgtttctcgaacagaat
ttgaagcaacaggtaatgatggagcagaatctcatcaaccagcaaatgctggaacagtca
gtccaaggccaggtcctcatggagcagcaggtacaacagaatcttctagaacaaaccccc
tcacaggcgcagctgcagcccaacttactcaaccaacagttaaccgcagaaattaacaac
cagaaccaggtcttacagcaacagatcattcagcaacaacagacgataatagcccaacaa
gcagccgccatacagcagaaacagtttgaagaacagctcacagctcaggacaacatgatg
tccgtcccgcagaatctcgtcaccggccaaatgctcgacccctcgctacagaacctacag
aacatactcgctcagatcatacagaggccggacacgctacagtctaggaaggagtcagaa
tctgaaacgcaatcccaacaaccacagcaacagcagcaacaacaaatgacacagcaacca
aacgagaacctcgaaatgcaacagaaccaggaacaggaagcgttgcagcaacaaatgcag
aatctaataggctcgcagcgacagcaacagaatgtgaactttcatcaaagtcaacagttt
gcccagccgacattacaacaactggctgttgatccaacattcctcgcgcaacagcaacaa
gtagcgcaagcccaacaacaggtcgctcaagcgcaacaacagctcgacatgcagaaacaa
gtgttgacgcaacaacagctggtactacaacaacagataataggccagcaacagctccaa
atgcctggacagactctctctccgcaacacttcaggcatttccaacaacaacaacaatat
ctagcacagcaggagttacaacttcaaacccaacagaatataatcacacagaactgggcg
atgttgctacaaaaacagcaattaatggatcagcaacagcagaaagtggaagagatcctt
cggtctcaacggccgatgtaccagcggcaggggtcagaacagagccagatcagttcggca
gacgtacacgatcagcaacaagtaatgatgccggaccagtacggacagaaacctcagctg
cagcagcagatgtcggtcgaccagatgcactacaacaaacagaggtctgatgaccactac
caccagcttactacaatgcagggccagtcactcccgcataacatgcagatgcagcaaaac
ttcagcgtggtgcaacaaaacgagaggcagatatctagtcatgaaggcactcccgtgcag
aattatactgccaatccgttgcaaatgtaccagcaagcgcagagccagcctgtccaaatg
atgccgaatgtgtaccagtccaatcaaatggagtcttccataccgtcgtctgtcgctgct
tccatgcctcaacagatgccgcaacctgtccaagatccgatgccgcagatgtcagttcca
cagtcaataccgcagtcgatgtcgtcggtgcctcaatcgatgccccagtcagtgccacaa
gcggtgcatgctgtgcctcagccggtgcattcggtgccccagccgatgcactcggtgcca
caaacggtgcagtcgataccgcagcctgtacaatcagtccctcagccgtcaacgctgtcg
catacaatacaacaacaaccgcaaccggtgcaatctatcccacaaccggtttccaatcag
gtgcaacaacagatacagccgatgcaacaacagatgcaaacgttgccttcgcaagttcag
cagatgccgcagccggtgcaatcgctaccccagtcgttacctccacaacctatgcagcaa
cttcctcaaacgcagcagatgcagatgcaacaagacttggtgcagcagccgcagcagctg
aacttgccttcggagcaggtggagaatgggtaccagagcaatgggggacagaaggagcag
ttccacacgccgctgacggagttccccaacaaccatgctgaggctatccgccagcctgaa
cttagctccgtcgaggagaagcagggggagacccagcaacaagaagcgggaacagcaata
tcttctccgataacgggcgagaaaaagtcccggggttccaaaaagcgttcccgggagaag
gacaagctgcccaaactgactgtcctggaggtcaatgaggcagccacgatggtggagtgt
caactggagtccaagtccaagactgtcaccttcaagttcgatgtcactgatgttaatcct
gaggagatcgctagtaatctggtatcaaataacctcctaccggaatggcagagcgcgacg
ttcatggagctgatcaaggacatcgtgagtcagctgctcagcaaccccggcgtcacgccc
gtgctcaaccctgcacaccactccgcgctcaggctcaatatcgataagactgactacgac
tcagaaacaacagaacgtgaggaaaacctcacagactcgaaccaggacaactcagaatgt
accacccccaccgccagccacgacaatattgctgccgagctggcctacgactccgccgag
cccgagcccgccccagccccggccccagccccagccccggccccggctataccggcacat
gttgatactgtggctaggaagattagtactgcttcttctataggttccaatcaatcagac
ggcgggtcaatggcaccagaacgctccggcagcacagagtcacagaacggcgagaagaaa
caatccaaacccactcgcaagatatcccgatttctagtcagccccgtcgtcgaccgcggg
gaaaacgttcccgaggacaaacctgctcccgagcccagcgaacccaaggaaccgcccaag
gaaccgcctaaagaaccagctaaggaaccgccccgggaaccacaagtcaacggcctcccg
gagaaagaagttccccccactctacccccacaagaatatgttcctactcaccagtattcc
gtaccagcacagatacagccacccgtagacttaagacctgagatccaacccgtcgagcga
cctgtcgaaagacctgtagagagacctattgaggtccctcaagaagtccctgtaacagtc
accatggtacctgctcctatagtttccaacatccagagtataccacaagtacctgtgcag
aatatcatcaatcctatgctagccgcttcgaacctgcaaccgaacttaacgactccttta
caaattgcgactgatacgccgttattggggctgagtcaggtggggacgccgatgggtgtg
ggtggggatttggggctgaatatggggctggggcaggtggggctgggcatgtcgacgcag
cagacgttgactccaacgccgggggtgaccgatgctatgccgaacgctgagaatatacag
aggatgctgttaaaacagaatattatgaaccagcaacaaaacctatcggggcccaaccta
ttgggtttactgaaccagcaaccctacccacaaccagacctcggcctacacaacaccata
ctcaataatgctcaaccagcgccgatgatggccgcccggctgccgccgcagtatccgcag
cagaagtactaccagccgatgctcgccaacgatttcattggactcaatccaatctttcca
tcatcagctcagcagcaggccctgcagtcttcagtgaaccagttggcttcgcagcagatg
agccagctcaacatgatgggcctaggcccgccgctgccgccccaggccttggccttccag
catcagaacatagcccagaatttagctctcaaccagaatctgatgggacagaatctgggt
cagaacttgggtaattatacaggtctagcaagtcaaaacttaggattaggcggtcagaat
ctcatagggggtcagaacctggctctaggcggtcagaacctggcactaggcggtcagaac
ttgggtctgatcaatcagaacttgggtcagttagtggcacatagggcggtgcaccatgcg
ttggcgaggagggctgttgatatggatatggcaggcatgacaaacgtgaattcaacaggc
tcgtcgcagccgtcgacgccgaacaaaccgcactcgtacaacgagtacatgctcaatctg
cagcacaagctagcctccatatctaacagcggtccggtgtcaccgcagtctcctttagaa
tacagccccgcgctgtcaccaacacaccgaccgcctctacacaacatgcctaaggtgttg
tcagcggagggcggcgctgcggcggagacggcgccggcacacaagagccggcacgcggcg
cagctcgccgagctcgaccacgagctgtccaagatcagcctgcactacaagcatgcgccg
cccaaggatgtgttcatagagcacaacgcggaagagcatgaaatgctcgcggcgaccatc
aacgatagtgcagtcaacacttatgaagcagagctgggcccggagtgggagtcgcggtcg
acgcggttccgcgtgtcccgtgctgcgccctgtcgcggctacgagctgtgcaggctgctg
cctggcgaccacgaaaaagagaagctggatcttctccaaagcgggtcgtacgggtcagga
gcactggactcagtctcctgcgccgacaacaactccgtgtgctccgaggcgggcggcgac
acatacgtcatcaccgacacccgcgcccacgcatacctcgtgcacgacgcgctggccggc
accaccaccaccatcatacacccgggacgagctcagcacgagcaggcatctcccccatcc
ccgccggagtcagaggaggatgtgtgcggggcggcgctggtggtggagacggcgcgcgcg
ctcacgtgcgccgtcctcgaccgcgcgctgcgcctgtcccccagcgagggcttcctgccc
ttccgggacgacaagtacgccgcccatgtgcaggccgaggcgggcagcgtgtcggccgtg
gaggagctgtcccggtggcagggcgtggcggtggcgggcgacgccgtgctgtgccccgcg
cggccgcagcacgccgccagcctcgtcacctacgagaccatcaccgacaggggtaacgca
acataccttacctaa

DBGET integrated database retrieval system