KEGG   Helicoverpa armigera (cotton bollworm): 110372719Help
Entry
110372719         CDS       T05609                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:haw00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110372719
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:haw03041]
    110372719
Enzymes [BR:haw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110372719
Spliceosome [BR:haw03041]
 Complex C
  Other components
   Step II factors
    110372719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Flavi_DEAD DUF2075 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 110372719
NCBI-ProteinID: XP_021185345
Position
Unknown
AA seq 1275 aa AA seqDB search
MDEVAKLEHLSLVSKVCTELDNHLGLNDKDLAEFIIDIADKNPAFDSFKKALIENGAEFS
DSFMTNLLRIIQHMKPTNTTQKAETSQEHSNPLANKFPGLAIPNEKPPKFSSDEESEEED
EKSTKRLTAKEIFKDESKADISDSVVDQAMAELEALAPSQGGPGRESKKDIPKEDIKKRE
RSHSRDRKDVSRRRERSRERDRDRKSRRSRSRDKRSSSRDRRSRSRDRRSRSRGRRSRSR
NRERDRRKRSRSRPTSSRHRSRDRQRRSKSRGRTSPSRGRSSPARGKRSPSREREHKYDY
GKKSRKRSPEVEMSDDPEPGKIYNGRVANIVPFGCFVQIEGVRKRWEGLVHISQLRSEGR
VTNVSDVVNRGDKVKVKVISVTGQKVSLTMKDVCQETGKDLNPTSHAHLEAEREGRNPDR
PPPNATVLAGLQGGLDPDEDSSRKRVTRISSPERWEIKQMISSGVIDKSELPDFDEETGL
LPKDEDGEADIEIELVEEEPPFLQGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKER
REQKMIQREQEMESLPMGLNKNWIDPLPESDGRALAANMRGTGITPQDLPEWKKHVIGGK
KSSFGKKTNLSLLEQRQSLPIYKLRDELTKAVADNQILIVIGETGSGKTTQITQYLAECG
LTARGKIACTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGML
LRECLMDLDLKTYSVIMLDEAHERTIHTDVLFGLLKQAVQKRPELKLIVTSATLDAVKFS
QYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEI
DTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSL
TIDGIYYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKCYRLYTER
AYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLIMALEQLHSLSA
LDSEGLLTRLGRRMAEFPLEPNLSKILIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQA
LADQKKAKFNQPEGDHLTLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIM
DRHKLDVVSAGKNTVRIQKTICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQP
EWVIYHELVQTTKEYMREVTTIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYE
EPNAWRISRVRRRRN
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagttgcgaaattagagcacctttctttggtgtcaaaagtttgtacagagctg
gacaatcatttaggattgaatgataaagatttagctgaattcatcattgacatagctgac
aaaaatcctgcatttgactctttcaaaaaggcacttattgaaaatggagcagaattttca
gattcctttatgactaacttgttacgtatcatacagcatatgaaacctaccaacacaaca
cagaaagctgagactagtcaagaacattcaaatccacttgccaataagtttccaggattg
gctatccctaatgagaagcctcccaaattttcttcagatgaagaaagtgaggaagaagat
gagaagtcaaccaaaagactgacagctaaagaaatattcaaagatgagtcaaaagctgat
ataagtgactcagtggttgatcaagcaatggcggagctagaagcattagctccgtcacaa
ggtggtcctgggagagaatccaaaaaagacattcctaaggaagatataaaaaagagggaa
agaagccacagtagagatcgcaaagatgttagtaggagaagggaaagatccagagagaga
gatagggatagaaaaagcaggcgtagcaggagtagagacaagagaagtagtagtagggat
aggaggagtcgcagtagggatagaagaagtcgtagtagaggccgtaggagtagaagtcgt
aacagggaacgagatagaaggaagaggtccaggagtcgccccacatccagtcgtcacagg
tctagagacaggcaaagaagatccaagtctagaggaaggacatctccatccagaggaaga
tcttctccagctcgaggcaagaggtctccgtctagagaaagggaacataaatatgactac
ggcaagaagtctaggaagaggagtcctgaggttgaaatgagtgatgatcctgaacctgga
aagatctacaatgggagagtggcaaacatagtaccatttgggtgctttgtgcaaatagaa
ggagtgaggaagagatgggaaggcttggtgcatatctcacagctgcggtcagagggccga
gtgaccaatgtctctgatgttgtcaatagaggcgacaaagttaaggtcaaagtaatatca
gtgactggacagaaagtgtctctcaccatgaaggatgtgtgtcaagaaactggcaaagat
ctgaatccaacatcacatgcacatttggaggctgaacgcgaaggtcgtaatccagatcgt
cctccaccgaacgccacagtgttagctggtctacagggaggcctggaccctgacgaagac
tcaagtagaaagagagtcaccagaatctccagtcctgagagatgggagattaaacagatg
atatcatcaggagtaatagacaaaagcgagctacccgactttgacgaggagacaggtctt
ctaccaaaagacgaagacggcgaagcagacatcgagatcgaacttgttgaagaagaacct
cctttcctacaaggacatggccgtgctctacatgacctgtcgccggtcaggattgtcaag
aaccctgacggttctctcgctcaagccgccatgatgcaatctgctttatccaaggagagg
agagaacagaagatgattcaaagagaacaagaaatggagagcttacccatgggactcaat
aagaactggatagatccactcccagagagtgacggtagggctttagctgccaacatgaga
ggtactggcataactcctcaagatttaccagagtggaagaagcatgtcattggcgggaag
aagtcctcatttggcaaaaagacgaacttgtcgcttttagaacagaggcagtcgttgcct
atttataagctgagagatgagttgactaaggccgtagccgacaaccaaattctcatagta
atcggtgagacagggtcgggtaagacgacacagatcacccaatatttggcggagtgtggt
ctaaccgctcgcggtaagatcgcgtgcacgcagccgcgtcgtgtggccgccatgtccgtc
gctaagcgtgtcgctgaagagttcggatgtcgcctcgggcaggaggtcgggtatactatc
cgttttgaagattgtaccagtcctgagacggttatcaagtacatgacagacggtatgttg
ctccgcgagtgcctcatggacctggacttgaagacctactccgtcatcatgttggacgag
gctcacgagcgcaccatccacaccgacgtactcttcggcctactcaagcaggccgtccag
aaacgaccagaactcaagctgatcgttacctcagctactttagacgctgtcaagttctca
cagtacttctttgaagcacccatcttcacaatccctggtcgtaccttcccggtcgaagtt
ttgtacacgaaagaacctgagacggattatcttgatgcatcccttataactgtgatgcaa
atacatttgagagagcctcctggagatattttgctgttcttaactggtcaggaggaaatt
gacacagcttgtgagattctatatgagaggatgaagtctttaggaccggatgtaccagaa
ctcatcatcttacccgtgtactcagcactgccttccgaaatgcagacgcgtatcttcgag
ccggcccctcccggctccaggaaagtcgtcatagctaccaacattgcggaaacatcgctg
accatagacggaatttattatgttgtcgatcctggatttgtgaagcaaaaagtttataat
tcgaagactgggatggactctttggttgtgacgcctatttcacaagcagcggctaaacag
cgagcgggtcgtgccgggcggacgggcccgggcaagtgctaccgactgtacacggagcga
gcctacagggacgaaatgttgcccacacccgttcctgaaatacagcgcaccaaccttgcc
accactgtgctgcagttaaagacgatgggtatcaacgacctgctacacttcgacttcatg
gacgcgccgcccgtggagtcgctcatcatggcgctggaacaactgcactcattgtccgct
ctcgattctgaaggattactcactaggctgggccgcaggatggcggaattccccctcgaa
ccgaacctttcaaagatcttaatcatgtcagttgccctccaatgttccgacgagatcctc
accatagtctcaatgctgagcgttcaaaacgtgttctatcgtcccaaagacaagcaagca
ctggctgatcagaagaaggcgaagttcaaccagccagaaggcgatcatctgacgttactg
gctgtttataatagttggaggaataataagttctctaacgcgtggtgttatgaaaacttc
gtgcagatacgcacgttgaagagagctcaagatgtcaggaaacagctgctgggaattatg
gatagacacaaactggatgtggtgtcagcgggcaagaacacagttcgtatccagaagacg
atatgttccggtttcttcaggaacgccgctaagaaggacccgcaagaagggtacaggacg
ctcgtcgacagccaagtagtttacatacatccttctagcgcgctgtttaataggcaacct
gaatgggtcatctaccacgagctcgtccaaactacaaaggagtacatgcgcgaagtgacc
accatcgatcctaaatggctggtggagttcgcgccagcatttttcaagttctccgatcct
accaaactgtccaagttcaagaagaaccagagattggagccgctgtacaacaaatatgaa
gaacccaatgcctggagaatatctagagttcgcaggagaaggaattag

DBGET integrated database retrieval system