KEGG   Helicoverpa armigera (cotton bollworm): 110373153Help
Entry
110373153         CDS       T05609                                 

Definition
(RefSeq) rho-associated protein kinase 2
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:haw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110373153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:haw01001]
    110373153
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:haw03036]
    110373153
Enzymes [BR:haw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110373153
Protein kinases [BR:haw01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   110373153
Chromosome and associated proteins [BR:haw03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110373153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like PH C1_2 C1_1 Seadorna_VP7 Pkinase_C PH_11
Motif
Other DBs
NCBI-GeneID: 110373153
NCBI-ProteinID: XP_021186009
Position
Unknown
AA seq 1308 aa AA seqDB search
MESLKDEERLRRLRALEERLCDPRSTGNVDCLLDTVTALVSDCDHPAIRRMKNVEAYTSR
YETFASDIVDLRMKAADFDLIKVIGRGAFGEVQLVRHKSTRQVYAMKLLSKVEMIKRSDS
TFFWEERHIMAHANSEWILKLHFAFQDHKYLYMVMDYMPGGDLVSLMSNYDIPEKWAKFY
TMEIVLALDVIHGMGFVHRDVKPDNMLIDKYGHLKLADFGTCMRMGPDGLVRANNAVGTP
DYISPEVLQSQNGEGVYGRECDWWAVGIFLYEMLIGDPPFYADSLVGTYGKIMDHRNSLQ
FPDDVEISKDAKSLIRGLLTDRIKRLGKNSVNEIKQHPFFINDQWSFENLRDSVPPVVPE
LSSDDDTRNFDDMEKSDALDESFPVPKAFVGNHLPFVGFTYNGDYQLCSRGLKAADVVDT
ISNNHINNVGSEAILQLEKLLERERDGRRKLEDTQVSLCAQLEELSQRESRNKKIIADTD
KELALLRHDLKEIQRKADIEAETRRKAEFNFNEAKRRLDEEQSKRAKEINNLQTYNDKIN
ALEMQLTELREKLKQESESAAKSRKQAAELTAAQAAAAAVNDGTVASLRAQRDSLERERS
TLSEELAAVKAAKQRSDAAVTEATSRLNAAHADLERSSGRLNQIMADNRQLSERVSSLEK
ECASLAHELRAAQHMYQQELRAHQDTQRSQLLSKQEANLELVKALQSKLNEEKTARQRSE
SVCQEKDRQMSMLSVDYRQMQQRLQKLEGEHRQETEKAMGLAASLEQERAARLAAGGEVA
AAEAAARAAAAERDARARDLHAVRAALHDASEKLAAASAERDMHCARSEELRQQLETEQH
YCFVYKSQANDMRLMLEENTRAARDSEQERSSLLHQLQLAIARADSEAIARSIAEETVGE
LEKEKTMKELEMRDALSQHRSELAARDALVQGLRDRDHENRATIDLQRKVIKDMNPATTK
NKSKMSVRKDKDYRKLQQELTREKEKFDQHISKLQRDLQDCQQQLLDEQSTRLRLAMEVD
SKDVEIEQLKEKLAALTSETASQSSADAEDGETEQTLEGWLSVPFKQNIRRHGWKKQYVV
VSSKKIIFYNTENDKQNTTDPVMILDLSKVFHVRSVTQGDVIRADAKDIPRIFQLLYAGE
GEARRPGDLADLPAEGGDHTGNTVQHKGHDLVSITYHIPTACEVCTRPLWHMFRPPQAYE
CRRCRMKIHAEHVSEGEGVAACKLHADRARELLLLAPGAPDQRRWVARLARRVQRYGYRA
AHHPHHDHTKLSPPRAHRDSMRSNLKSAYMNASQRSSTLPANASLPRQ
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgctgaaggacgaagaacgtttgcggcggctgcgcgccctggaggagcggttg
tgtgaccctcgctccaccggcaacgtggactgcttgctggacaccgtgacggcgctcgtc
tccgactgcgaccacccggctatccgtcgtatgaagaacgttgaagcatatacaagtaga
tatgagacttttgcttcagacatagtagacctgcgtatgaaagcagcagattttgatttg
ataaaagtgattggccgtggggcatttggtgaagtgcaactagtcagacacaagtctaca
cgtcaagtgtatgccatgaagttactcagtaaggttgaaatgatcaaaagatctgattcc
acattcttttgggaagaacggcacataatggcacatgctaactctgagtggatattaaaa
cttcattttgcttttcaagatcacaagtatctttacatggtcatggactatatgcctggc
ggtgaccttgtaagccttatgtcaaactatgacatacctgaaaaatgggcaaaattctat
acaatggaaattgtcctagcattagacgtaattcatggtatgggttttgtacaccgagat
gtaaaaccagataatatgctaatcgacaaatatggccatctaaaactagctgattttggt
acctgtatgagaatgggacctgatggacttgtgagggcgaataatgctgttggcactcct
gactacatctcacctgaagtcttacagtcacagaatggtgagggggtgtatggtcgggaa
tgtgactggtgggctgtgggaatatttttgtatgaaatgttaattggtgatcctccattt
tatgcagacagtttggtcggaacatatggtaaaatcatggaccatcggaattcactacag
tttcccgatgatgttgaaatctcaaaggacgccaaatccttgatcagaggtcttctaaca
gaccgaataaaaagattaggtaaaaatagtgttaatgaaatcaagcaacatccattcttt
atcaatgaccagtggagttttgaaaatttgagagattctgtaccaccagttgtgcctgaa
ttatctagtgatgatgatacaaggaattttgatgatatggaaaagtctgatgccttggat
gaatcttttcctgtgcccaaagcttttgtaggtaatcatttgccatttgttggctttaca
tacaatggtgattatcagttatgctccagaggactaaaggcagcagatgtagtagacact
atttctaataatcatattaataatgttggatctgaagctattttgcagctagagaaatta
cttgaacgagaaagagacggtagacgaaaattggaggacacccaagtaagtttatgtgct
cagttagaagaattgtctcagagggaatctagaaataaaaaaataattgctgatacagat
aaagaattagctttattacgacacgatctgaaagagatacaaaggaaagctgacattgaa
gcagagacaagaagaaaagcggaatttaatttcaacgaagcaaagcggcggcttgatgag
gagcaaagcaaacgagcgaaagaaataaacaatctacaaacatacaacgacaaaataaat
gctctggaaatgcaattgacagagttgcgtgaaaaattaaagcaagaatctgagtccgct
gccaagtcgaggaaacaagcggccgagctgacagctgcgcaggccgcagccgctgctgtt
aatgatggcacagtggcgagtttgcgagctcagcgagacagcctggagagggaacggagt
actttatcggaggaacttgctgctgtaaaggcagctaaacagcgttcagacgcagctgtc
acagaagccactagcagattgaacgcagctcatgctgatctcgagcgatcttcgggcagg
cttaatcaaatcatggcggataacaggcagctttcagaacgcgtgtcgtcgctggagaag
gaatgcgcgtcgctggcgcacgagctgcgcgccgcccagcacatgtaccagcaggagctg
cgcgcgcaccaggacacgcagcgctcgcagctgctctctaaacaagaagccaacttggag
cttgtcaaggctcttcaatccaaactgaacgaggagaagacggcgaggcagcgctccgag
tccgtgtgccaggagaaagatcgccagatgtccatgctcagcgtcgactaccggcagatg
cagcagcgcctgcagaagctagagggagaacatcgacaggaaactgagaaggcgatgggg
ttagcggcttcgctggaacaggagcgcgcggctcggctggcggcgggcggcgaggtggcg
gcggccgaggcggcggcgcgcgcggcggcggccgagagggacgcgcgcgcccgcgacctg
cacgccgtgagggcggcgctgcacgacgcctccgagaaactcgccgctgcctctgcggag
cgcgacatgcactgcgcgaggagcgaggagctacgccagcagctggagacggaacagcac
tactgcttcgtgtacaagagccaggcgaacgacatgcgtctgatgctggaggagaacacg
cgggcggcgcgagactccgagcaggagcgctccagcctgctgcaccagctgcagctcgcc
atcgcgcgcgccgactccgaggccatcgccagatcaatagcagaagagacagtaggcgag
ctagagaaggagaagacgatgaaagagctagagatgcgcgacgcgctgtcacagcaccgc
agcgagctggcggcgagagatgcgctggtgcaggggctgcgggaccgggaccacgagaat
agggctaccattgatctgcagaggaaggtaataaaagacatgaaccccgcgacgacgaag
aacaagagcaagatgtcggtgcgcaaggacaaggactaccgcaagctgcagcaggaactg
actcgcgagaaggagaagttcgaccagcacatctccaagctgcagcgcgacctgcaggat
tgtcagcagcagctgctggatgagcagtccacgaggctgcgactcgccatggaggttgac
agtaaagacgtggaaatcgaacagctaaaagagaaactggcggctctaacaagcgagacg
gcttcacaatcatcagccgatgcagaagacggcgagacggaacagaccctcgagggctgg
ctctccgtgcccttcaagcagaacattcgccgacacggctggaagaagcaatacgtcgta
gtgtcctctaagaagatcatattctataacaccgagaatgacaagcagaatactacagat
cctgtcatgattttggatttgagcaaagtgttccacgtgcgttcagtgacgcaaggcgac
gtgatccgcgcggacgcgaaggacatcccgcgcatcttccagctgctgtacgccggcgag
ggcgaggccaggcggcccggcgacctcgccgacctgcccgccgagggcggagaccatact
ggcaacacggtgcagcacaaggggcacgacctggtgagcatcacgtaccacatccccacc
gcctgcgaggtgtgcacgcgcccgctgtggcacatgttccgcccgccgcaggcctacgag
tgccgacggtgccgcatgaagatccacgcggagcacgtgtcggagggcgagggcgtggcg
gcgtgcaagctgcacgcggaccgcgcgcgcgagctgctgctgctggcgcccggcgcgccc
gaccagcgccgctgggtggcgcgcctcgcccgccgcgtgcagcgctacggctaccgcgcc
gcgcaccacccgcaccacgaccacaccaagctctctccacctcgtgcccacagggactcg
atgcgctccaacctgaagtcggcgtacatgaacgcgtcacagcgcagctcgacgttgccg
gccaacgcgtcgctgccgcggcagtga

DBGET integrated database retrieval system