KEGG   Helicoverpa armigera (cotton bollworm): 110374530Help
Entry
110374530         CDS       T05609                                 

Definition
(RefSeq) muscle M-line assembly protein unc-89
  KO
K12567  titin [EC:2.7.11.1]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:haw01001]
    110374530
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:haw04131]
    110374530
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:haw04812]
    110374530
   04147 Exosome [BR:haw04147]
    110374530
Enzymes [BR:haw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110374530
Protein kinases [BR:haw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   110374530
Membrane trafficking [BR:haw04131]
 Others
  Actin-binding proteins
   Others
    110374530
Cytoskeleton proteins [BR:haw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     110374530
Exosome [BR:haw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110374530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 110374530
NCBI-ProteinID: XP_021187954
Position
Unknown
AA seq 1065 aa AA seqDB search
MGNHQSASHYVHKPSKNVRWKTAGRPATPGKPDIIPILSDEEPNSITLKWAPAAHDGGAP
LLGYQVECNRLGAPDWIRTAPPVVLRPELVLTGLEPPYRYQFRVAALNAVGRSDYSDLSD
VLTVSSDRLPHEPPLFLQHLEDLTVLENDKTEFRVAFSGTPPPTIAWFKDDYEIFSSRRT
AITTSDSTSVLVFHQTLPSDEGEIKCTATNRSGHAVTKARLSLEAAPKLRYPRQYEDGLL
YEINETVFLKTTIVGKPTPTVEWRHDGQPIVVDDRVEISNTSKFSMLKIHSARRSDRGEY
QIHAKNSIGEDTAAFLVTITAPPDPPQRVSVARQVDKSVTLDWEPPEDDGGCRIGNYVVE
YYRQGWNVWLKATTSRKTNITLFDLIEGSEYRFRVKAESPYGMSAPSVESAPVRIPGRPV
DMEFLAVESKIINEVLTREDGSADTRVSPAPRRKRAHTAPTEAQPPARQPRRSPARDPSG
SSEFMLVLYPDSQKQMEKSEKRQSIQLDLDALTPPPLSFSAPELSSRCMMPFKALRNAVS
SSQLLHELAMARVHKAVAMKEEQNRNKDDRPPNHKTDIPYNTSYDRENVRKNQDMPKSHE
EISEAKFKKPEMITKEESVDNSQNTLSAPQVSVDSETSDHKWQHMSFDEDYTASTVSSDG
EYTDEGSLDGEIDRRSQYSNEEETYNPRDKMARPSPLKDFIEEEEEDVSENEPLKPLPLP
DPNFVPKPILKRREPELLEIKPIPAPELPKVEEKSKPKEKPKISEKIKIGKSAITEKSNA
TEKLKTTEKLKAMEKPKKEEKLTIFKKITNTKFPKLLHKKETEKTPEENVPNDNLKTNNK
IDKMQDKVSEEGRTVIDYYGSIVKEYGSQKKSAAPMYLKTEDLKAVAEKQQLEMKPENTE
ENQVATPKKIVNKTNNSTATPKKGKTTNSINKSVKTKQPNNSVKNIPDKKTKTTAATPPE
NQNDTQKKCTQQVVLRKAERATIVIPINYQELEEKAKMNVRSAIDYTVDVCLLLLAFWVY
FFKDERLAIPFLILIIYRQLQETLLLNIPEWYKRYTPSWLKKKTS
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccaccagtccgcctcacactacgtccacaagcccagcaagaacgtgcgctgg
aaaaccgcaggacggcctgcaaccccaggaaagccagatattataccgatactatcggat
gaggagccgaattcgatcacgttaaaatgggcaccggcggcacacgacggaggcgcgccg
ctgctgggctatcaagtggagtgcaaccgcctgggcgcccccgactggatccgcacggcg
ccacccgtcgtgctgcggcccgagctggtgctcaccggcttggagccgccctaccgctac
cagttccgcgtcgcagcgctcaacgccgtcggccgctccgactacagcgacctatccgat
gtgctcactgtcagctccgaccgacttcctcatgaaccaccgcttttccttcaacattta
gaggatttgaccgttcttgaaaatgataaaacagaattccgagtcgctttctctggtaca
cctccaccaactatagcttggttcaaagatgattatgagattttcagcagtcgaagaacg
gcgatcactacgagcgattctacgagtgtccttgtcttccatcaaacgttacctagcgat
gaaggtgaaataaaatgcacagcaacaaatcgcagtggacacgcggttacaaaagcccga
ttgtcactggaagcagcaccgaagttacgctacccgcgtcaatacgaggatggattgtta
tacgaaattaacgaaaccgtattcttgaaaactacgatagttgggaaaccaacacctaca
gtagaatggcgacatgacggtcaacccatagtggtagacgaccgagttgagatttcgaat
acttcaaaattttcgatgctcaaaatacattcagcacgacgaagcgaccgaggggaatat
cagattcatgcgaaaaacagcatcggagaggacaccgcagctttcctagtgacgataacg
gcaccaccagaccctccgcagcgagtgtcggtagcacggcaggtcgacaagtccgtcacc
ctggattgggagccgcccgaggacgacggcggttgtcgcattgggaattatgtggtggag
tattatcgacaaggctggaacgtgtggctaaaagcgaccaccagtcggaagacgaacatt
actctctttgatctcatcgaagggagtgagtatcgttttcgtgttaaagcggagagtcca
tacggaatgagcgcgccgagtgttgagtcagcgccggtgaggataccgggccggccagta
gacatggagttcttggctgtggaatcgaagataataaatgaggtccttacacgtgaagat
ggcagtgctgacactcgcgtgtcgccggcaccgcggcgtaagcgcgcacacaccgcgcct
accgaagcacagcctcccgcgcggcaaccgcgccgctcgccagcccgggacccctctggc
agcagcgaattcatgttggtactctacccagattcgcaaaaacaaatggaaaaatccgaa
aagagacaatcgatacaactggatctggatgctctaacgccgcctccactctcgttctct
gcgccggagctgagctctcgctgcatgatgccattcaaagcgctccgtaatgccgtcagc
tcgtcacagctactgcatgaactagcaatggcgcgtgttcacaaagctgtcgctatgaaa
gaagaacaaaacagaaacaaagacgatagaccccctaatcacaaaactgacattccgtat
aatactagctatgatcgcgaaaacgtgagaaagaatcaagatatgccaaaatcgcacgaa
gagatctctgaagcaaagttcaaaaaaccagaaatgataactaaagaagaatctgttgac
aactcacaaaacacgcttagcgcgccacaagtttcagtagattctgaaacatctgatcat
aagtggcaacacatgtcttttgatgaagactacacagctagcactgtttcttcggatggg
gaatatacagatgaagggagtctcgatggagagatagaccgacgaagccaatattctaac
gaagaggaaacatacaatccgagagacaaaatggctaggccttcgcctcttaaagacttc
attgaagaggaagaagaggatgtgtcagaaaacgagcctctcaaacctttgccacttcct
gatcctaattttgttccaaaacctatattaaagcggagagagccagaactactggaaatc
aagccaatccctgcacctgaacttccaaaagttgaagagaaatcgaaacccaaagaaaag
ccaaaaattagcgaaaaaatcaaaattggaaaatctgcaataacagaaaaatctaatgca
actgaaaaacttaaaacaacagaaaaacttaaagcaatggaaaaacctaagaaagaagaa
aagcttacaatatttaagaaaatcactaatactaagttccctaaattacttcataaaaag
gaaaccgaaaaaacgccggaagaaaatgtgcccaacgataatcttaaaacaaataataaa
attgataaaatgcaggacaaggtaagtgaagaaggaagaacagtgattgattattatggt
agtattgtaaaagagtacggtagccaaaagaaatcggcagcacctatgtaccttaaaaca
gaagacttaaaagctgttgctgagaagcagcaacttgaaatgaagcctgaaaatactgaa
gagaaccaagtagcaacaccaaagaagattgtgaataaaacaaataacagtacggcgact
cctaaaaaaggaaaaactacaaattcaatcaacaaatcagttaagaccaagcaacccaat
aacagtgttaaaaatatacccgataaaaaaaccaaaacaacggctgctactcctcctgaa
aatcaaaacgatacgcaaaagaaatgtactcaacaagtagttctaagaaaagctgagcgc
gcgaccattgttatacctattaactaccaagaacttgaagagaaggcgaagatgaacgta
agatctgctattgactacacagtagatgtttgcttgcttcttttagctttttgggtctat
ttctttaaagatgagagactcgccattccttttctcatactgatcatatatcgacagtta
caagaaacactcctgttgaatattcctgagtggtacaaacgttatacacccagctggctc
aagaagaagacttcttga

DBGET integrated database retrieval system