KEGG   Helicoverpa armigera (cotton bollworm): 110374534Help
Entry
110374534         CDS       T05609                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:haw01001]
    110374534
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:haw04131]
    110374534
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:haw04812]
    110374534
   04147 Exosome [BR:haw04147]
    110374534
Enzymes [BR:haw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110374534
Protein kinases [BR:haw01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   110374534
Membrane trafficking [BR:haw04131]
 Others
  Actin-binding proteins
   Others
    110374534
Cytoskeleton proteins [BR:haw04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     110374534
Exosome [BR:haw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110374534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C1-set Ig_6 BiPBP_C C2-set_2 Receptor_2B4 Ig_4
Motif
Other DBs
NCBI-GeneID: 110374534
NCBI-ProteinID: XP_021187959
Position
Unknown
AA seq 4815 aa AA seqDB search
MEKQSRWSEQRSEQRSEQRVQQHTERREQVMQQQERVQRTEQHYTRQMLTQQVESAGDRL
PVTLGRPGEPSPPIFEQIFKNARFAQGGNAKFEGKLRGNPTPVVSWTRKKAPLVECNKYS
MSYNEQTGDVSLLIKQIGPGDEGEYTCTARNQYGEAICSVYIQPEGVPVPAHQASQQQSY
RHVSESVEHKSYGTQGYSTEQSSKTQKVAYTNGTDYSSTEDFKVDTFEYRLLREVSFRET
ITKRYVNESDTHISTEIDRTLGPVSPPKIAQKPRNSKLQEGADAQFQVQLSGNPKPRVTW
FKNGQRLVNTSKHEIVTTHNQTTLRVRNTQKSDSGHYTLLAENPNGCIVTSAYLAVESPQ
ETYVQDQRSQYIMDSQQTGIEERVEISEKALAPQFVRVCQDRDVTEGKMTRFDCRVTGRP
YPEVTWFINDRQIRDDYNHKILVNESGNHALMITNVELSDSGVVTCVARNKSGETSFQCR
LNVIEKEQVVAPKFVERFSTLSVREGEPVILNARAVGTPTPRITWQKDGVPIIPNPELRI
NTDGGASTLDIPRAKASDAAWYQCTAQNVAGSTATRARLYVEVPKEPPPEQKRLHLPRPT
KIIEPEPAPGPEIIYLRHVERARPYIPPGEEDRVYPPPQFIVPLKSISQMEGGKIHFETR
IEPVGDPTMKIEWLRNGQSIEASSRFTSIFRFGYISLDMLSLNIQDTGEYTCRAISATGV
AETKAMLQVTPRATIERTSQHPESLQYIQQLEDYSRYQHQESIEEQISQRPQFIRPLQEL
GELQEGRNAHFEAQLTPVSDPTMRVEWYKDGRPITASSRITSIFNFGYVSLNIMHLRAED
AGSYTVRAVNKLGEAISTASIRVAARSTVTADLGIPEQRRYIEKTEQLEAYQQQQHQKYY
QEAPESTQKPEFKTPIKDQINIKEGGFAHFEARLEPVGDSTLRVEWLKDGRPVEASSRIT
TFFNFGYVALTIKSVTIHDAGHYTCRAYNALGQAATSANLTIVTKKDIIAESQHPGGYEK
IQHLEDSSRYSRRAEEEVRVTQKPRFLGPLKGTNKIVEGQSAHFEARVEPQSDLTMTVEW
YFNGKQIKSANRIQTYHDFGYVALDIASVRSDDTGVYTVVARNAAGEAQLSASMTVETRS
SIDTSSIHRGLYEKTRHIEESKFVEPMYEIEEISKSKPVFVQPLSDPAPVSEGKNIHLEC
RLEPMGDPTMRVEWFHNGRAVTVGSRFRTYYDFGFVALDIIHATSSDSGEYTVRAVNHLG
SAHTSAMVRVIERSDIVTDTQNEQAVEQIQMLEDAARRSRQVHEDITVRQAPQFSRALHN
IETVEGTNVHLECRLQPVGDPTMRVEWFCNGRPIKTGHRFRPAYEFDYVALDLLSVYPED
SGVYTCQATNQLGEAVTSCALRVIAKKDLIFESQHPSGLEKIQYLEDASRYKKSEVVDES
INIKPRFITKPKSIDNVVEGHHVHFECKLEPVTDSNLKVEWFKNGHPVTIGHRFRPIHDF
GYVALDIIDLIAEDTGVYTCRAVNLVGTDEVSCRLTCRSTADIVRATQNEAGLTQIQSLE
DRSKHHRTDFVDEVTTQAPIFTTSLKNIEIKEGQRAHFECRLIPVSDPTMKVEWYHNNKP
LKSGSRFTETNNFGFVALDIMSCLPEDSGTYTCRAINALGEAVTSGIAIVHSRKSIYLES
QHEGALPRLNQLEDTSRYQRHSAQDESITQAPVFTMPMKDIRVAENQAAHFEARLIPVGD
TKLRVEWLRNGVPIEASNRLTTMHDFGYVALNMKYVNPEDSGTYTCRAINELGEAVTSST
LFVQSKASLQLESQHESALEKIQQLEDSSRYRRREDVEVAVNQAPRFITQLNGPSRLVEG
QSAHYECRIEPYPDPNMRVEWYFNGKVLQSGHRYRTAYDFGFAALDILTVYGEDSGEYTC
KVINNLGQATSSIKLNVQSKESIIRDTQHESALEKIQYLEDDSRYKRVVRDESFVAEKPQ
FGKPLKNAEVSEGKPVHLEATLTPVNDPTMRVEWFCNGRPVQQGHRFKTTYDFGYVALDI
LYAYAEDSGTYMCKATNAVGEAVTTGSVKVDAKAGLYLDTLDEQRLKKIQELEQYERPKP
VQEEQPGQRPVFLTALTSLENLKEGDHAHFECRVEPINDPDLKIEWFLNGQKIRAGHRYR
TTHDFGYVALDILYTYSEDSGTYMCKATNKLGEAVNTCTMKVAGHRSIILDTQHPNGLEK
IRQLEAQGHHTRMEVEEPKVSPPRFVTELRGTTHVFEGQTAHFECQVEPVHDPNLRIEFY
HNGKALQSAARFHITFDFGYVSLDIQHCVPEDAGEYSVKAINALGQCTSSISMTVTAKGS
IISESQRPEGLEKIRELESAEPFKRPEIPEPVTRQRPVFTQPLQNIDNIQEGQTAHFDCR
LIPVGDPTLKVEWFRNEKLIEDSSRITKTHDFGYVSMTITHVRDEDEGVYMCRASNLLGE
AVTTAAMRIKTKAAIQMDTQHPEGMKKIQQLEQPQQRRPDEPEREFEKPIFTQVLTGPSE
LWEGQHAHYEARVVPVGDPSLRFEWYINGVELKMGSRFRTTHDFGFVTLDINSVVAEDAG
LYMCKAINKAGSTVSSASLKIKTKSTIVDQTMRPEAWEQIQLKEAAMNKVPEMFVDSGVQ
QAPIFTTHLKSYDKLVEGQHVYLEAQVEPRTDPNLRIEWFKNGMSLTTGSRLKSTFDFGL
VTLSINSVRIDDSGIYTCKATNLMGEAVSTASIKIEDRHWLLGETLHPESLDRIGALEQP
KAGKPEAPEPVYEIPVFISHLNNILCKEGENIHFECNVEPSRDPTLKIEWFFNNKPLPSG
SRYKSTHDFSYVSLDITHTYEEDSGIYTCKATNSKGSATTSGSLRCTGDKNIYFDTQHPQ
GKAGLEAVEQAEEARLSKSRRTSVPDVEYPKPEWVVPVAAENQLIEGQALHLEGQVEPKN
DPNLRIEWYFNGKVLEQGSRFKLTSDFGFVTLDLTDVYERDSGIYTCKAYNKRGEAFTSS
TVFCTSKENLIERTQHPKGTEGLEKIQNLEESLRREPGQKPDDDTGRPPEFTTVFQDIVD
ISEGQIAHYEASLIPTGDQSMVIEWFYNGKSIEASHRIRTVYAFGMVVLEILGTKTTDSG
VYSCRATNRWGQAEISVKLECVDKSKGQKPRFTTHIQNIEGLKDGQSAHFECTVVPVDDP
DLKIEWYHNGQPLRHSTRIKTVSDFGFVVLDIAYTQNHDTGEYVCRAYNKYGEDFTKANI
TCFGRGGVYLDSLQPDSLAKIRELESLQGMQQQAPAPASAVPPKFITQIQDVTKLAEGQS
AHFEARLVPVDDPDLKVEWFYNGKKLPHGHRYRTFHDFGIVILDILYCYEENSGVYECVA
TNKLGRDSTKATLKCTSKENLILDSQLPRGMEGGLEKLQTLEDSMIRRKDVKEEEERGKA
PVFTVPLSNIDNLREGENAHFEARLTPTDDPNLKVEWYWNGKSLKAGSRFRTFCDFGFVI
LEISPTYPEDSGEYLCRAYNNYGEAVTTATMKVQGKRNIILESQLPKGMEGTIDKIAALE
GYTGTVDSMTPEAETGNPPEFTTTPSDLILSENSSAHFECRLIPVNDSSMRVEWFHNGKP
LLTGSRVKTINDFGFVILEIGGVYQRDAGLYTCKATNRHGEATVSCKLQVKGRQGIILEP
QLPSHFKSGTESIQKLEETLHKREEITIEDEKPNPPKFIVEIKDNIDVPEGGPIHFDCRV
EPVGDPTMRIDWFYNGRPFATGSRVHMLNDFGFIALDIDYIYARDAGEYTCRATNKWGSA
TTTAKITCSAKRDIVLESQLPQGMSGEKIKELERGRVSDAPKEEPVISSPPKFITQIQSH
TVEESESVRFECRVEPKEDPKLRIEWYRNGKLLPSGHRYRTVYDMGFVSLDILYVYAEDS
GEYVCRAVNDIGEDFTRATVSCKQLPDIILQNQVPRGMKKSEALTQMEATIKKYTSEIFL
TEDDLYDADKKQPPRFVTQIESQTTLVEMESTKFECQLAPVGDPNMKVEWFFNGKPLLHK
NRFTPIYDFGYVAMNFGWVYPEDSGEYLCRATNLYGMDETRAVIKTAGKPGIVYDSQLPK
HMKSIEKIREMEAAWQMVPEEAAEEAKARSPPVFVSRPDPVTVEEGEWARFCCRVTGHPK
PRVMWLINGNTIVNGSRYKLTYDGMYHFDIPKTRQYDTGKIEVIARSSAGEALATTELKV
IPRHDDYRGVLKNAPRPWYDETTQYQRSETELEKTFEERQVLQRQGVIDHRPELKPKVIK
EPETEWQQTVKKKKSEEYYNKLQELENEQVIKESRFRESTHQYAIPGEKIASSSIAKGMA
QRYEDTLEQTEVTTEQVQQKKVAKPRIPPGPSESTVHGKEVHVAKQKQIQKEVVGDTEIT
RKITSTETTEMEHKAQTQERVVEGPVKPSKPPVFTKKMQPCRVFEHEQARFEVEFDGDPL
PTIKWYRENFPIKNSADFQIHTFSTKSILIIRQVFVEDSAVFAAVAENRGGTAKCSANLV
VEERRKQGRGGVAPPSFTLTAQNVNVTAGQLVRFDTKVTGTKPIDVYWLKNGKKVQPDIR
NKILEEDGTYTLLILEAYPQDSGKYECVAINSAGEARCDAECSVNAPATKEKPKPQTKAA
NAPPEIIEPLKDKVVAEGQAIEFSCKIVGKPAPTVQWFKGEKLIKPSKYFQMSRTADEYT
LRISEAFPEDEGDYKCVAYNSAGRVTVAAKLKVTQPDQADNLPTLTPLRDLVVYEGQPAQ
FKTQITSKVKPTIQWLREGALIPETPDFQMIHEGNNAVLLIGNTYEEDTGTFTCRATTAA
GQVETSAKLVVKSKT
NT seq 14448 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcagtcgaggtggtcggagcagcgctccgagcagcgctccgaacagcgcgtg
cagcagcacaccgagcggcgcgagcaagtgatgcagcagcaggagcgcgtgcagcgcact
gagcagcactacacgcgccagatgctcacccagcaagttgaatctgctggcgatcgcttg
cctgtcacattaggcaggcctggcgaaccttctcccccaatctttgagcaaatcttcaaa
aatgcaaggtttgcgcaaggcggaaatgcaaaattcgaaggaaaacttagaggcaatcct
acccccgttgtatcgtggacgagaaagaaagctccactggtggagtgcaataagtatagt
atgagctacaacgaacaaaccggtgacgtgtccttattaattaaacaaatcgggccgggt
gatgagggcgaatacacatgcacggctcgcaatcaatacggcgaggccatttgctccgtg
tacattcagcctgaaggcgtcccggtgcccgcgcaccaggcctcgcagcaacagagctac
aggcacgtcagtgagagcgtggaacacaaatcgtatggtacacaggggtactccacagaa
cagtccagtaaaacacaaaaagtcgcatacaccaatggcactgactattcatccacagaa
gatttcaaagtggacacctttgagtacagacttttaagggaagtatcattcagagaaaca
attactaagagatacgtgaatgaaagtgacactcacatcagtactgaaattgatagaacg
cttggaccagtgtcaccacccaaaattgcacaaaagccgaggaattctaaacttcaagaa
ggtgctgatgcccagttccaggtacaactatctggtaacccgaagccgcgcgtgacttgg
ttcaagaatggacaacggcttgttaatactagcaagcatgagattgtcactacacataat
caaacgactcttagggtaaggaatacacaaaagtctgactctggccattacactttattg
gctgaaaatcctaatggatgcattgtcacatcagcttatcttgctgttgaatctccgcaa
gagacgtatgtgcaagatcaaagatcacagtatatcatggactctcaacaaacaggaatt
gaagaaagagtagaaattagtgaaaaagctctcgctccgcaatttgtaagagtctgccaa
gaccgcgatgtcacggagggcaaaatgacgcgattcgattgccgcgtcacaggcagacct
tacccagaagtcacgtggttcattaacgatagacaaattcgagacgattataatcataag
attttagtaaacgaatcaggtaatcatgcgcttatgattacaaacgtcgaacttagtgac
agtggtgtagtcacgtgtgtagcgcgcaacaagagtggagaaacatctttccagtgcaga
ctaaacgtcatcgaaaaggaacaagtagttgcaccgaaattcgttgaacgtttcagtact
ttaagtgttcgcgaaggagaaccagttattttgaatgcacgcgcagttggcacacctaca
ccacggatcacatggcagaaggacggcgttccgataatacccaatccagagttacgaatt
aataccgatggtggggcctcgacgctggacattcctcgagccaaggcgtcggatgcggca
tggtaccagtgcaccgcccagaacgtcgcaggctccaccgccactcgggcaaggctctac
gtcgaagtaccaaaagagcctccgcctgagcagaagcgtctgcacttgccgcggcctaca
aagattatcgagccagaacctgctcctggaccagaaatcatttacttaaggcacgtggaa
agggcaagaccttacattcctcctggtgaggaagatcgagtttatcctccaccgcagttt
attgtgccactcaagagtatttcacagatggagggtggcaaaatacactttgaaacgagg
atagaaccggttggcgacccaacgatgaaaatagaatggttaagaaatggacaaagtatc
gaagccagttctaggtttacatcaattttccggtttggatatatttctctcgacatgctc
agtcttaacattcaagatactggagaatacacttgcagagcaataagtgcaacaggagtt
gcagaaactaaggctatgttgcaagtaactccaagagcaaccatcgaaagaacaagccaa
cacccagagagcttacaatatattcaacagttggaagattattctagatatcagcaccaa
gagtcaatagaagaacagatttctcagaggccacaatttatacggcctcttcaagagctt
ggtgaattacaagaaggcagaaacgcccatttcgaagctcaacttactccagtcagtgat
cctactatgagagtagagtggtacaaagatggtagacccattacagctagctcgcgaatc
acgtcaatcttcaacttcggttacgtctcccttaacatcatgcacctacgggctgaagat
gcaggttcgtacacagtgagagctgtaaataagttaggtgaagccattagtaccgcttcg
atcagagtagctgctaggagtacagttactgccgatcttggcataccagaacaacgacga
tacattgagaagactgagcaattggaagcatatcagcaacaacaacaccaaaagtattat
caggaagcacctgaaagcactcagaaaccggagttcaaaacaccaattaaggatcaaatc
aatattaaggaaggtgggttcgctcattttgaagctcgcctcgaaccagtaggtgattca
actctgagagttgagtggctgaaagatgggcgtcctgttgaagccagttcaagaataact
acattctttaacttcggatatgtcgcattaacaataaaatctgtgaccatacacgatgct
ggtcactacacttgccgagcttataatgctcttggtcaggcagctaccagtgctaaccta
accatagtaacaaagaaagatataatcgccgaatctcaacatccaggtggatacgaaaaa
attcaacatcttgaagattccagccgatattcaagacgcgctgaggaagaagtgagggtt
acacaaaagcctcgatttttgggaccattgaagggaactaataaaatagtagaagggcaa
agcgctcactttgaagcaagagtagagccacaaagtgatctgactatgactgtagaatgg
tattttaacggaaagcagattaagagtgctaatcgcattcagacgtaccatgactttggc
tacgtagcattggatattgccagcgttcgctctgatgataccggagtttacaccgtcgta
gcccgcaatgcagctggagaagcccaactgagtgcttctatgacagtggaaacacgatcc
agtattgacacgtcgagtattcaccgtggtttatacgaaaagactaggcacattgaagag
tccaagtttgtggaaccgatgtatgagattgaagaaatctccaagtctaaaccagttttt
gttcaacctctatctgatccagctccagtatcagaaggtaaaaatattcacttagaatgc
aggttggaacccatgggtgatccgaccatgcgcgtggaatggttccataatggaagagcc
gtgacagtcggctcaagattcaggacttactatgactttggatttgttgcactcgacatc
atacacgcaacatcttctgactctggagaatataccgtgagagctgtaaaccacctggga
tccgctcacacatccgcgatggttcgtgttattgaacgatcagatattgtaactgacaca
caaaacgaacaagctgttgaacaaattcaaatgctggaagatgctgcgcgtagatctaga
caagtacatgaagacattactgtgaggcaggcacctcaattctctagagctttacataac
attgagactgtagaagggaccaatgtgcatttggagtgtagattgcaaccggttggtgat
ccaaccatgagagtagaatggttctgcaatggaagaccgattaaaacaggacacaggttt
aggccggcctatgaatttgattacgttgccctagaccttctgagtgtctatcctgaggac
tcaggtgtatacacatgccaagctacaaaccaacttggtgaagcagtaacttcttgtgct
ttacgagtaattgctaaaaaagatcttattttcgagtcgcaacacccatcaggactagaa
aaaatccaatatttggaagatgcctcacgttacaagaagagtgaggtagttgatgaatcc
ataaatataaaacctcggttcattacaaaaccaaagtctatcgacaatgtggttgaaggt
caccatgttcatttcgaatgcaaacttgaaccagtgacagattctaacctgaaagtagaa
tggttcaaaaatgggcaccccgtgactattgggcacagattccgcccgattcatgatttt
ggctatgtcgcacttgacataattgacctgattgctgaagacaccggtgtttacacatgc
agagccgtcaacctcgtcggtactgatgaagtcagctgcagattgacctgccgcagcact
gcagatatagtcagagcaacacaaaatgaagccggtcttacacaaattcaatcacttgaa
gataggtctaaacatcacaggaccgatttcgttgatgaggttactacgcaagcaccaata
tttactacctcactgaaaaacattgagatcaaagaaggccaaagagctcacttcgagtgc
aggctgatacctgtttcagatcctactatgaaagtagaatggtatcacaacaacaaacca
ctaaagagtggatcaagatttacggaaaccaacaactttggttttgttgctcttgacatt
atgtcttgcctacctgaagattccggaacgtacacctgcagagctattaatgctctcggt
gaagcagtaacatctggaattgctattgtacattctaggaaatcaatttacttggaatcg
cagcacgaaggagctcttccaagacttaaccaactagaagatacttctagatatcaaaga
cacagtgctcaagatgaatctattacacaagcaccggtgtttacaatgcctatgaaggac
atacgagtagctgaaaaccaagctgctcatttcgaagcaaggctcattcctgtcggtgat
acgaaactccgagtggaatggctacgcaatggcgtacctattgaagcttcaaaccgcttg
acaactatgcatgactttggttatgttgccttgaatatgaaatatgtaaatccggaagat
tctggaacttatacatgccgtgctatcaacgaactaggtgaagctgtaacatcatctaca
ctattcgttcaatctaaagcatcgcttcaactggagtctcagcatgagagtgccttagag
aaaatccagcagttggaagattcttctcgctaccgacgcagagaggacgtcgaagtagcc
gtcaatcaggcaccgagattcatcacacaactgaacggaccatcgaggcttgtagagggc
cagagtgctcattatgaatgccgtattgaaccgtacccagatccaaatatgcgggtagag
tggtactttaatggaaaggtccttcaaagcggccaccgttatcgcacagcttatgatttc
ggatttgctgcacttgatatcttaacagtatatggagaagattctggtgaatatacttgc
aaggttattaataacctgggccaagccacctcttcaatcaaattgaacgtgcagtctaag
gaatccatcataagagatacacagcatgagagtgctcttgaaaagatacagtacctcgaa
gatgacagtcgctacaaacgtgtagttcgggatgagagcttcgtggctgagaaaccacaa
ttcggaaagccattgaaaaacgctgaagttagtgaaggcaagccagtacacctggaagct
acccttactccagtaaatgatcccactatgcgtgtggaatggttctgtaacggtagacct
gtacaacaaggtcatcgattcaagacaacatacgactttggttatgtcgcgctagatatt
ctgtatgcttacgctgaagacagcggcacgtacatgtgcaaagctactaacgctgtcggc
gaagctgtcaccactggctctgtgaaagtagatgctaaagccggactttacttagacaca
ttagacgagcaacgtctcaaaaagatacaagaactagaacagtatgagagaccaaaaccg
gtgcaagaggagcagccaggtcagaggccagtgttcttaacagccctgacgagcttggag
aacttgaaagaaggagaccatgcacacttcgagtgtagagtagaaccgatcaacgacccc
gatctaaagatcgaatggttccttaacgggcaaaagataagagctggccacaggtacagg
acaacacatgacttcggttatgttgccttagatattctgtacacatactctgaagattct
ggaacttacatgtgtaaggccactaataaactcggggaagcagttaatacatgcacgatg
aaggttgcagggcacagaagtatcatccttgacactcaacatccaaatggtttggagaaa
attagacaacttgaagcccaaggccatcatacaaggatggaagttgaagaacctaaagtt
agtccacctaggtttgtcacggagttacgtggaacgactcatgtatttgagggtcagaca
gctcactttgaatgccaggtggagccggtacatgatcctaacttgagaattgaattctac
cataatggcaaggccctgcaatctgctgcacggttccatatcacttttgattttggttac
gtgtcattagatattcagcattgcgtcccagaggacgctggtgaatactcagtgaaggca
attaatgcattaggccagtgtacatcatctatatctatgacagtaaccgcaaaaggaagc
attatatcggaatctcaacgtcctgaaggcttggaaaagatccgagagctagaatctgcg
gaaccgtttaaacgtcccgaaattccagaaccagtaacacgccaaagaccagtattcact
caacctcttcaaaatattgataacattcaggaaggtcaaacagctcactttgactgtaga
cttattccagttggtgaccctacccttaaagtggaatggttcagaaatgagaaacttatt
gaggacagttctagaattacgaagacccacgactttggttatgtgtcgatgactatcacc
catgttcgtgatgaagatgaaggcgtctatatgtgccgagcttccaatctattgggcgaa
gcggtaacgactgctgccatgagaataaaaacaaaggcagccattcaaatggatacacaa
catccagagggtatgaagaaaatccagcaacttgaacaaccacagcaaagaaggcctgat
gagcctgaacgcgagtttgaaaagcctatctttacccaagtacttacgggaccctcggaa
ttgtgggagggacagcatgctcattacgaagcacgagtagtgcctgttggtgacccaagc
ttaagatttgagtggtacatcaatggagtagaactcaaaatgggttccagattccgcacc
actcatgatttcggatttgtcactttagacattaattcggtagtagccgaagacgctggc
ctttacatgtgcaaagcgataaacaaagctggcagcacagtatcttctgcttctctgaag
atcaagacaaagtcaaccattgtagatcagacaatgagacctgaagcttgggagcaaatt
caattgaaggaagccgccatgaacaaagtaccggagatgtttgtggactcaggcgttcaa
caggcaccaatcttcaccacacatcttaagagctatgataaactcgttgaaggacagcac
gtttacttggaagcccaagtagaaccacgaactgaccctaacctcagaattgaatggttc
aagaatggtatgtctctcacaaccggctcaagattaaagagtacattcgattttggtttg
gtaactctttccatcaacagtgttaggatcgacgattctggaatttacacctgcaaagca
accaacttaatgggagaagctgtatcaaccgcttccattaaaatagaagatcgccactgg
ctacttggtgaaacgcttcaccctgaatctttggataggataggtgctcttgaacagcct
aaagctggcaaacctgaggcccctgaacctgtatatgaaatacccgtatttatatctcat
ctgaacaatattctatgcaaagaaggtgaaaatatacatttcgaatgtaacgttgagcct
tctagggatcctacacttaagattgaatggttcttcaacaataaaccgctaccatccggt
tcgagatataagagtacacacgatttcagctatgtgtctcttgatattactcacacttac
gaagaagattctggtatttacacatgtaaggctacaaacagcaagggttctgcaactaca
tcaggctcgttaagatgtactggagataaaaacatatatttcgatacccagcaccctcaa
ggaaaggctggattggaagcagttgaacaggcagaagaagcacgtttgtcaaaatctagg
agaacgtctgtacctgatgtagagtacccgaaaccggaatgggtggtacccgtagccgca
gaaaatcaattaattgaaggacaagcccttcaccttgaaggacaggttgaaccaaagaat
gatcccaacctcagaattgaatggtactttaacggaaaagttttagaacaaggttcaaga
ttcaagcttacaagcgattttggctttgtaactttggacttgactgatgtgtatgagaga
gacagcggaatttatacttgtaaggcttacaataagaggggtgaagcctttacatcatca
accgtgttctgtactagcaaagaaaaccttattgaaagaacacaacatcctaaaggcact
gaaggattggaaaagatacaaaacttggaggagtctctgcgtagagagccaggtcagaaa
cctgatgatgacactggaagacctccagaattcacaaccgtattccaagatattgtcgac
attagtgagggacagattgcccactatgaagcatctctcattccaacaggagatcaaagt
atggtcattgagtggttctacaatggaaaatctattgaagctagtcatcgcattcgtaca
gtttatgccttcggtatggttgtacttgaaatccttggaactaagacaactgattcggga
gtgtactcatgccgagcaaccaacagatggggacaagcggaaataagcgtcaagttggaa
tgtgttgacaagagcaaaggacagaaaccaagatttaccactcatattcaaaacattgaa
ggtttgaaggatggtcaatcggctcactttgaatgcacagttgtgccggttgacgaccca
gacttgaaaattgaatggtatcataacggccaacctctgcgccactctactagaattaaa
acggtttcagactttggttttgttgtccttgacattgcatacactcaaaaccatgatact
ggtgaatacgtttgccgtgcgtacaacaagtacggcgaagacttcactaaggctaacata
acttgcttcggaaggggtggagtttatctcgacagcttacagcctgattcgttggctaaa
atcagggaattggaaagcctgcaaggaatgcaacagcaagcgcctgcgcctgcatcagct
gtgccacctaagttcattactcaaattcaagacgtgactaagttagcagaaggtcaaagt
gcacactttgaggctagacttgtgccagttgatgatccagacctaaaagttgaatggttc
tacaatggcaagaaattgcctcatggtcacaggtacaggactttccatgacttcggaatt
gttatattggatattctttactgctatgaagaaaactcaggtgtatacgagtgtgtggct
actaataagctcggacgcgattctacaaaggctacgttgaaatgtacttcaaaggagaat
ttaatcttggactcgcaactaccgcggggcatggaaggtgggttggaaaaactgcagact
ctcgaagactccatgatacgcagaaaggatgtcaaggaagaagaggaacggggtaaagct
cccgtcttcacagtgccgctttcaaacatcgataaccttcgggaaggagaaaatgcacac
tttgaagcgagattaacaccaactgatgaccctaacttaaaggtggagtggtactggaat
ggaaagtcacttaaggctggttccaggttcagaaccttctgcgactttggttttgtcatc
cttgaaatttctccaacttaccctgaagattctggtgaatacttatgcagggcatacaac
aattatggagaggcagttacaacagccacaatgaaagtacaaggaaagcgaaacattatt
ctggaatcacaattacccaaaggcatggaaggaaccattgataaaattgcggcccttgaa
ggctacactggtactgtagactccatgactccagaagctgagactggtaatcctcctgaa
ttcaccactacaccttcagatctcattttatctgaaaattcttcggctcactttgagtgc
cgtcttattcctgttaatgattcgagtatgagagtagaatggttccataatggaaagcca
cttctcaccggatctagagtaaagaccattaatgatttcggattcgtaatattggaaatt
ggtggtgtataccaacgtgacgctggtctctacacctgcaaggccaccaaccgacatgga
gaagcaactgtttcttgcaaactacaagtcaagggaagacaaggtatcattttggaacca
caattaccatctcacttcaagtctggtactgagagcatccagaaattggaggagactctg
cacaagcgagaagaaattacaattgaagatgaaaagcccaacccacctaagtttatcgta
gaaatcaaagacaacattgatgtccctgaaggtggaccgattcacttcgactgtcgtgtt
gaaccagttggtgatcccactatgagaattgattggttctacaatggccgacctttcgca
accggatcgcgagttcatatgctcaatgatttcggatttatcgctctggacatcgactat
atttatgctcgtgatgctggagagtatacttgtcgcgctaccaacaaatggggttccgca
accactactgctaagatcacctgcagtgctaagcgtgatattgtattagagtcccagctt
ccacaaggtatgagcggagagaaaatcaaggagcttgaaaggggccgtgttagtgatgca
ccaaaggaagaacctgttataagcagcccgcctaagttcatcactcagatccagtcgcac
acagttgaagaatcagaaagcgtacgatttgaatgtcgcgtggaacctaaagaagacccg
aaactgcgtatcgaatggtaccgtaatggcaagcttttgccttctggccataggtaccgc
actgtttatgatatgggtttcgtttcacttgacattttgtacgtttatgctgaagactcg
ggtgaatacgtatgccgtgcagtaaatgatattggcgaagatttcactagagctacagtg
tcttgcaaacaactaccggatattatcctgcaaaatcaagtaccacgaggaatgaagaaa
tcggaggcactcactcagatggaagccaccattaagaagtatacttcagaaattttcttg
actgaagatgacttatatgatgctgacaagaaacagccgccacgcttcgtaacccagatt
gaaagccaaacaactttggtggaaatggagtccacgaagtttgagtgccagttagctcct
gttggtgatcctaacatgaaagtggaatggttcttcaatggaaaacccttattgcacaag
aaccgattcacgcctatttacgactttggttacgtggctatgaactttggttgggtttat
cctgaagacagtggtgaatacctttgccgtgcaaccaacctgtacggtatggatgaaacc
cgagctgttatcaaaacagctggtaaacctggtattgtttatgattctcaattaccgaag
cacatgaagagtattgagaaaataagagaaatggaagccgcttggcaaatggtacctgaa
gaagcagcagaagaggcaaaggctcgatcaccgccagtctttgtaagccgtccagaccca
gtcaccgtcgaggaaggcgaatgggctcgtttctgctgccgagtcaccggacaccccaaa
ccacgagtgatgtggctcatcaatggcaacactatcgttaatggttctagatacaaactg
acgtacgatggaatgtatcatttcgatattcctaagacaaggcaatacgacactggtaaa
atcgaagttattgctagaagttcagcaggcgaagctttggccacgactgaacttaaagtt
attccgagacacgacgactacagaggggttctaaagaatgctccacgaccatggtacgat
gaaactacacagtatcagcgctctgaaacagaattagagaaaacgtttgaggaaaggcaa
gttttgcaacgacagggagttattgaccacaggcctgagttgaaaccgaaggtcattaaa
gagccggaaacagaatggcaacagactgtcaagaagaagaagagtgaagagtattacaat
aaactgcaggaactcgaaaatgagcaggttattaaggaaagtcgatttagagaatccact
catcaatatgctattcctggggaaaagatcgctagtagttctattgccaagggcatggct
caaagatacgaggacaccctggaacaaacggaagttacaactgaacaagtacagcagaag
aaagtagcgaagcctagaattccgccaggcccatctgaatctaccgttcatggaaaagaa
gtacatgttgccaaacagaaacaaattcagaaggaagtggtcggagatacagaaattaca
cgtaagattacttctactgaaacaactgaaatggaacataaagctcagacacaagaaaga
gtagtggaaggacctgtgaagcctagcaagcctccagtatttactaagaaaatgcaacct
tgccgtgtgttcgaacacgaacaagccagattcgaagtagaattcgatggagacccactg
ccgaccatcaagtggtacagggagaacttccccattaaaaactccgctgacttccagatc
cacacatttagcaccaaatccattcttatcatcaggcaagttttcgttgaagactctgct
gtatttgcagctgtggctgaaaaccgtggaggaactgctaaatgtagcgctaacttagtt
gtagaagagcgcagaaagcaaggaaggggtggagttgcaccaccaagtttcactttaaca
gctcaaaacgttaatgtgacagccggtcaactagtcaggtttgataccaaagtgactgga
acaaagcctattgatgtttactggctgaagaacggaaagaaagttcagccggatatcaga
aacaaaatactagaagaagatggcacatacacccttcttattcttgaagcttatccccaa
gattcgggtaaatatgagtgtgttgctataaacagcgctggagaggcacggtgtgacgct
gagtgttccgttaatgcccctgctaccaaagaaaaaccaaaacctcaaactaaagccgct
aacgcgcctcctgaaattattgaacccctgaaagataaggttgttgctgaaggtcaagcc
attgaattcagttgcaagatcgttggaaagccggcacctacagtccagtggttcaaaggc
gaaaaattgattaagccgtcgaagtacttccaaatgtcacgcactgcggacgaatacact
cttcgcatatctgaagctttcccggaagacgagggtgactacaaatgcgttgcttacaac
tcggctggccgagtgactgttgccgcaaaacttaaagtaactcagcctgatcaggccgat
aatctgccaactttaacacctctacgagatctggttgtttatgaaggacagccagcacaa
ttcaaaactcaaataaccagcaaagtcaaaccgacgattcagtggcttcgagaaggtgct
cttatccctgaaacgccggacttccagatgatccacgaaggcaacaacgccgtgttgctg
atcggcaacacgtacgaggaggatactggaaccttcacttgccgggccaccaccgccgcc
ggccaagtcgagacatcggctaagctagtcgtcaaaagtaagacatag

DBGET integrated database retrieval system