KEGG   Helicoverpa armigera (cotton bollworm): 110375755Help
Entry
110375755         CDS       T05609                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: insulin-degrading enzyme-like
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:haw01002]
    110375755
Enzymes [BR:haw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     110375755
Peptidases and inhibitors [BR:haw01002]
 Metallo peptidases
  Family M16: pitrilysin family
   110375755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C Ribosomal_60s Cytomega_UL84
Motif
Other DBs
NCBI-GeneID: 110375755
NCBI-ProteinID: XP_021189679
Position
Unknown
AA seq 810 aa AA seqDB search
XRLDQLNKSTASPSHPFHKFGTGNRETLETIPKSKGIDVRKELLKFHSKWYSANIMTLVV
VGKEPLDDLEEMVVKLFTEVEDKSVTAPSWPEHPFPPALRRKRAYCLPVKDLRSLSIDFP
IPDTRKHYKSGPGHYLSHMLGHEGPGSLLSALKARGWCNSLVGGTRIGARGFGFFGVQVD
LTEEGVAHIDDIIKLVFQYMEMLKVAGPQRWVWEEQRDLMALEFRYKDKLEPRNLVTGHV
HLLQEFPMEDVLCAYYLMTEWKPELIQELLSLLTPENVRVGIVAKCFAEKCTMTEPWYGT
KYLQEDIEDSKIQLTLESGEDSTAHSVAPTVILDSPLMRLWFKKDSEFHLPKAVMTFDLV
SPLAYMDPLSCNLTSVWVLLLRDSLQQFAYAAELAGLRWSIGNAKYGISVTIDGYDDKQS
VLLDKIMDQMIGFTADPKRFHIMKENHIRAIKNFEAEQPYQHAVYQQALCLADVVWTRCQ
LLEAADRMTPEMVNDFAARMIRKVHIEGFMYGNLSRERALHIAESVEKKLPKDATPLCAQ
QLLLHRDIEIEKGSWHVRETTNSVHRSSCASLYYACGVRECRSNVILELLAHTLAEPCFS
MLRTKEQLGYIVFSGLRRSNGVQGFRVIVQSHRHPEYLEERIESFLQGSLDYLKNMSDVE
FMKHRAALSAQKLEKPKRMSSRAAQMWNEITAQVYNFDRPRVEVEELNTITKEELIEFYK
KHIAMDSPERQKLSVYIISTAEGGAGHSPEPKEEKEEKEKEEGGDEDECDRCYPKPTKIV
DLVDFKCRRPLYPHPSPYINIPRKGSQCKL
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
tgaaggctggaccagctcaacaagagcacagcctccccctcacaccccttccacaagttt
ggtacaggtaatagagaaacgttagaaacgataccgaagtcaaaagggattgatgtcagg
aaagaactgctgaaattccactccaagtggtattccgccaatattatgactctcgtcgtt
gtggggaaagaaccactagacgatctagaagagatggtggtgaaactcttcaccgaggtc
gaagacaagtcagtcaccgcgccctcgtggccggaacacccgtttccaccagcgctgcgg
cggaagagagcctactgtctaccggtcaaggatctgcggtcattgtccatcgactttcct
ataccggatactaggaagcattataagagtgggccgggacactatctctctcacatgctg
ggacatgaaggtccagggagtctgctatccgcgttaaaggccagaggatggtgtaatagt
ttagtgggaggtacgcgcatcggcgctcgtgggttcggcttcttcggcgtgcaagtcgat
ctgacggaagagggagtcgcccatatcgatgatatcattaaactggtgtttcagtacatg
gagatgctgaaagtagctggtccccagcgatgggtgtgggaagaacaaagagacctgatg
gcgctagagttcaggtataaggacaagttggagcccaggaatctggttacaggacacgtg
catttgctgcaggaattcccaatggaagatgtactatgtgcatactatttgatgacggaa
tggaaacccgagttaatacaggaactactatctttgcttacacctgaaaatgtacgcgtt
ggcatcgttgcaaagtgtttcgcggaaaagtgcacgatgaccgagccttggtacggaact
aaatatctacaggaagacattgaagattctaaaatacagcttactctagagagtggcgag
gacagcaccgcgcattctgtggcacctactgttattcttgattccccattaatgaggtta
tggttcaagaaggacagcgaattccatctacccaaagctgttatgacgttcgatttagtc
agtcccctagcctacatggaccctctaagctgcaacctgacctccgtctgggtgcttctc
ctccgagacagcttacaacagttcgcgtacgccgccgaactggccggccttcggtggagc
atcggtaacgccaagtacggcattagcgtgactatagacggttacgatgacaaacagagc
gttctactagacaagattatggatcaaatgatcgggtttacagctgatccgaagagattt
cacatcatgaaggagaatcatatacgagccatcaagaactttgaggctgaacagccttat
cagcatgcagtataccaacaagctctgtgcttagctgatgtcgtgtggaccagatgtcaa
cttctagaggcggctgatcgcatgaccccagaaatggtgaacgattttgccgcccgcatg
attcgtaaagtccacatagaagggttcatgtacggaaatctatcacgtgagagggcgctg
catatcgctgaatctgttgagaaaaaattaccaaaagatgcgacgcctctctgtgcccaa
cagttgttgttacacagagatattgaaatcgaaaaaggatcctggcacgtaagagaaact
acgaacagcgtacaccgttcgtcctgtgcttctctatactacgcgtgcggggtccgggag
tgtcgcagcaacgtgatactggaactgctggcgcataccctcgccgagccctgcttcagc
atgctacggaccaaggaacaactcggctacatagtcttcagtggtcttcgaagatccaat
ggagtacaagggtttagagtgatagtccaaagccacagacatcctgaatacttggaggag
aggatagaaagcttcctgcaagggtcattggattatctaaaaaacatgtcggatgtggaa
tttatgaagcacagagctgctttgtcggcgcagaaactcgagaaacccaaacgtatgtct
tcgagagctgcgcagatgtggaacgaaattactgcgcaggtgtacaactttgacaggccg
agggtagaagtcgaagaactgaataccatcactaaagaggaacttattgagttttataag
aaacacatagcaatggactctccggagcgacagaaactgtcggtgtatatcatatcgacg
gccgaaggaggggcgggacatagtcctgaaccgaaggaggaaaaggaggaaaaggagaag
gaagagggaggggatgaagacgagtgtgaccgatgctatcctaagccaacaaaaatagtc
gatctagtggacttcaaatgcagaagacctttatacccgcacccatcgccttacataaac
atacctagaaaaggatcgcagtgtaaactttaa

DBGET integrated database retrieval system