KEGG   Helicoverpa armigera (cotton bollworm): 110376453Help
Entry
110376453         CDS       T05609                                 

Definition
(RefSeq) N-acetylneuraminate lyase-like
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00520  Amino sugar and nucleotide sugar metabolism
haw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    110376453
Enzymes [BR:haw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     110376453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-GeneID: 110376453
NCBI-ProteinID: XP_021190604
Position
Unknown
AA seq 303 aa AA seqDB search
MVSFTARGLMPPVFTPLNDDLTINYGIIPAYAKFLADSGIKSVLVGGTTGEHMSLSVADR
KKVIDAWVAVAKTTGLHIQVQVGGAPLADVTELVRFLGKKKINSLLTLPELYFKPASVQD
LVFYVSQVAKAAPKLPVLYYHIPSMSKVEINMPAFVSAATVSITNFKGIKFTSNDLSEGA
QVLRTLKDGQEMFLGADTLLAPAALLGIKSSIGTSFNLFPKLAQEILDAVEKNDIAKARA
LQEKLSLAIEAHTCEGPWVPIMKAGMEIATGIKVGPPSLPQKPLSAEAKQRIRAKLSTLG
LSK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccttcacagcccgtggtttaatgcccccagtgttcactccgctgaacgatgat
ctgaccatcaactatggaatcatcccggcttatgctaagttcctggccgattcaggaatt
aaatctgtgttggttggaggcacaacaggcgagcacatgtccctgtcggtggcagatagg
aagaaggtcatagacgcctgggttgccgttgccaagaccactggtctccatatacaggtg
caagtgggaggagcaccactggctgatgtcactgaactggtaagatttttaggaaaaaaa
aagattaactccctcctaacactgccggagctgtacttcaagccggcgtcggtccaggac
ctggtgttctacgtgtctcaggtcgcgaaggcggctcctaagttgccggtgctgtattac
catataccgagtatgagtaaggttgagataaacatgccagcattcgtatccgcggctaca
gtgagcatcaccaacttcaagggcatcaagttcacgtcgaacgacctgagcgagggcgcg
caggtgctgcggaccctcaaggatggacaggagatgttcctcggagctgatactctcctt
gcgccagcagcgctcctaggcatcaaatccagcattggaacaagtttcaacctgttccct
aaacttgcccaagaaatcctggatgccgtagagaagaacgatatcgctaaggctagagct
ctgcaggagaaacttagcttggctatcgaagctcatacttgtgaaggaccctgggtaccc
atcatgaaggctggcatggaaatagccacgggcatcaaggtcggacccccatctctaccc
caaaagccactgtcagctgaagccaaacaaaggatcagagccaaactgtccactttaggc
cttagcaagtaa

DBGET integrated database retrieval system