KEGG   Helicoverpa armigera (cotton bollworm): 110376890Help
Entry
110376890         CDS       T05609                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00020  Citrate cycle (TCA cycle)
haw00640  Propanoate metabolism
haw01100  Metabolic pathways
haw01200  Carbon metabolism
Module
haw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
haw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110376890
   00640 Propanoate metabolism
    110376890
Enzymes [BR:haw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     110376890
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     110376890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA MBF2 Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 110376890
NCBI-ProteinID: XP_021191199
Position
Unknown
AA seq 226 aa AA seqDB search
MVRVKHALLRQNKSRLLGPNCPGIICPPANCKIGIMPASIHKPGCIGVVSRSGTLTYEAV
QQTTEQGLGQTLCVGIGGDPFNGTNFIDCLDLFLKDDNTKGIVLIGEIGGNAEEQAAEFL
IERNTVSIKKLGWIRTAPSTSNQALDRRLRYTLSERYQVNAVSIVEVGPPQGGAPAFVGG
LGTNVIDVVLVSARGRGFEYNIELWGHDTTGADPGPNPPDVLITEL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcgtgaaacacgcacttttacggcagaacaagtcccgtctattgggccccaac
tgcccaggcatcatctgtccgcccgctaactgcaagattggtatcatgccggcatccatc
cacaagcctgggtgcattggtgttgtgtcccgatcaggcaccctaacttacgaagctgtc
caacagaccactgagcaagggctgggccagaccctttgcgttggtattggaggtgatccg
ttcaacggtaccaacttcatcgactgcctagatctcttcctcaaggatgacaacacaaag
ggcattgtgctcatcggagaaatcggtggcaacgccgaggaacaggcagctgagttcctc
attgaacgcaacacagtaagtatcaaaaaattaggttggatcaggactgcaccatctacg
agcaatcaagcactcgacagaaggttgcgctacacgctgagcgaaaggtaccaggtgaac
gctgtctccatcgtggaggtcggtcccccacaggggggagcgccggccttcgtgggggga
ttggggaccaacgtcatcgacgtcgtgctggtgtccgcgcggggcaggggcttcgagtac
aacatcgagctgtggggacacgacaccaccggcgccgaccccggacccaacccaccagat
gtcctaataaccgaactgtaa

DBGET integrated database retrieval system