KEGG   Helicoverpa armigera (cotton bollworm): 110377243Help
Entry
110377243         CDS       T05609                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00010  Glycolysis / Gluconeogenesis
haw00562  Inositol phosphate metabolism
haw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110377243
   00562 Inositol phosphate metabolism
    110377243
Enzymes [BR:haw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110377243
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110377243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110377243
NCBI-ProteinID: XP_021191722
Position
Unknown
AA seq 431 aa AA seqDB search
MKLLLTVLAICSIQTVSSTFCFWNTGCPYKYFSNKTPYNSVRGDIRDSVVKLTGCEPVSI
WGLIRHGQRNPGTEFGKHMKEALVIKEHVEASYNKGNCSLCAQDVENLLNWQVNMEMFDK
PFQLTKEGYQESEGIGRRFKQAFPKLLEKLDQHDYLFRPAQGAWMADSAKGFVKGLGNKD
LTIQPPKTNFDILSPYDTCKKYITDVKGNPETYAPSVRYLSSSEYLASKDRIQRRLGINY
ILTDTNITALYDLCRYTTSGLENKLSPWCALFTTQDLKVLEYIADLRHYYKSGYGTPINE
LLGQITLTDLLKSFKDAKSGKGKKITSYVTHATMMDMVYTALQLFKDDEPLSTSQRKADR
KWRSSKLAVFSSNLMAVLNKCDKAVDDYNVVFYFNEEPLQSICREGVCTWQEFEDKLSPF
TETNTEFCHNE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcctattaactgtattagcgatttgttctatacaaactgtgagctccacgttt
tgtttttggaacactggctgtccatacaaatatttttctaacaaaactccttacaactca
gtgaggggtgatataagggattctgtggtcaaacttactggttgtgagcccgtaagcatt
tggggcttaattagacatggccaaagaaacccgggtacagaattcggaaagcatatgaag
gaagctctagtcattaaagaacacgtggaagcgagctacaataaaggaaactgctcgctc
tgtgctcaagatgttgaaaatttacttaattggcaagttaatatggaaatgtttgataag
cctttccaacttaccaaagagggttatcaggaatcggaaggtattgggcgaagatttaaa
caagctttcccaaaattgctggagaaacttgaccaacatgattatcttttccgccctgca
caaggagcttggatggcagacagtgccaaaggttttgttaaaggcttaggcaataaggat
ttaactatacaaccacccaagactaacttcgatattttgtctccttatgatacgtgcaaa
aaatatattactgatgtgaaaggcaatccagaaacgtacgcgccatcggttagatatctg
agttcttcggaatatttggcttcaaaagacaggatccagagacgtctgggtatcaattac
attttgactgacacgaatataacagcgttgtacgacttgtgccggtacacgacttcagga
cttgaaaacaaattaagtccttggtgtgcgctgtttacgacgcaagatttgaaagttctg
gagtacatagctgacttgaggcattactacaaaagtggttatggaacgcccatcaacgag
ctacttggtcagattactttgaccgacttgctcaaaagttttaaggacgcgaaaagcggg
aaaggaaagaagattacaagctacgtgacgcatgctactatgatggatatggtgtacaca
gcccttcaattgttcaaagacgatgaacctttatctacctcccagcgcaaagccgatcgg
aaatggaggagtagcaaactagcagtattttcctccaacctaatggccgttctgaacaaa
tgtgacaaagcagtagatgactacaacgttgtattctacttcaacgaagaacctttgcaa
tcaatctgcagggaaggcgtttgtacttggcaagagtttgaagataaactatctccattc
acagaaacaaacacagaattttgtcataatgagtag

DBGET integrated database retrieval system