KEGG   Helicoverpa armigera (cotton bollworm): 110379696Help
Entry
110379696         CDS       T05609                                 

Definition
(RefSeq) dedicator of cytokinesis protein 6-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
haw  Helicoverpa armigera (cotton bollworm)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:haw04131]
    110379696
Membrane trafficking [BR:haw04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110379696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 110379696
NCBI-ProteinID: XP_021195134
Position
Unknown
AA seq 1077 aa AA seqDB search
MTLGRKYQQSSGNAGEARKVYSNQSKVGTLSGCSSSISLCDMIEPPDYEEVCDRLMGERD
PLAYPAVDMELCNVPRRIRTIAHVLPDEDLAKAPMFVRDCIRCYTTDYTVVEYKHRAYSG
SMCGRERLGERLERLHAGPRHQYEVDAEPSAASEEPQSESQPSSGRQSVASMSSSSSCNE
TLTPRGSWASLDLRSSSSDPLLPDLFERKPPEQVDAVNEARRLENRQADLLGLYTPYLDE
EEAVERRLPADMPSEIMGHRILVVCHQLKLELDVEPLFASMALYDAKEKKKISENFYFNL
NSECTRQMLASHVPHADLSTLSRSAVFDILNPSPDIFLVVRVEKVLQGDVNECVEPYIKD
DKNREKVRSGAAAACARLGKYRMPLAWSAVSLLNILSGSNSLERDQDKDSLNNCPNTNSL
DRKASSSSLEQLRRRAGEVGGSLTRKGSIERRAPAHHADDLAAMLDTFKPIVITVTSFFK
QIEVSPCPEELKNGLTPELAKLHPYGDDNVRPCKEILSFPTHAPAMPHYQYRNLLYLSVK
EINLNAYTSRAGSARNITVRIQLMSGENEESALPAIFGRSSCPEFTNEAYTTVLYHNKNP
SLYDEIKLKLPADLGDQHHLLFTFLHVSCQRKPEGNIPPRIGLANMESELRASITELPTA
NVEVLARYLPVVLDKLLHLLVAPPALAGQTLNIAQDVFTCLAHLFTDISNMNEGATCDNH
GRSSLISTYIQYQCTIPRPSLTDRDIGLPLPPADIEVEVANYSYIFPDVLLPGTRWIDNH
KPIFSITLDAHTTVHPLLMVKSMVEYLYWSGAHEARRKARFPDQFTDDVTTLVNNVTTEI
ISRYGKDSRLTQSLNNSLAFFLFELLSVMDRGYVFTLIRTYYKHMCAKIASLPDAVPLVH
YKLAFLRIICSHEHYVPLNLPSSGGSPGGVSPAASWASLGSQSSAPPRHALHHEFRSRHY
LAGLLLTELTNALDLQCTQFYTEFQNHIYFSSLQHGPLHXLTDRDIGLPLPPAVMTDGSC
KILHEELALQWVVASGATRDLAMQNSWALFELMVKSMVEYLYWSGAHEARRKARFPD
NT seq 3233 nt NT seq  +upstreamnt  +downstreamnt
atgactcttggacgtaaataccagcaatcttccgggaatgctggggaggctcgtaaggtg
tattctaaccagtcgaaggtcgggactctatctggttgctcgtcttctatatcactgtgc
gacatgatagaaccgccggactacgaggaggtatgcgaccgcctgatgggggagcgcgac
cccctcgcctaccccgcggtcgacatggagctgtgcaacgtgccgcgacgcatccggacc
atcgcgcacgtgctgcctgatgaagacctggcgaaagctccaatgttcgtccgcgactgc
atccgctgctacaccacagactacacagtggtggagtacaagcaccgagcgtactcgggc
tccatgtgtggacgggagcggctgggcgagcgcctggagcggctgcacgccggcccgcgc
catcagtacgaggtggacgcagagcccagtgcggcgagtgaggagccgcagtctgaatct
caaccatcaagcgggcgacaatcagtagcgtctatgtcgtcatcgtcctcctgcaacgag
accctcactcctcgcggctcctgggccagcctggacctcaggagctcctcctcagatcct
ctgctgccggatctgtttgagaggaagccaccggaacaggttgatgctgttaatgaggct
agaaggttggagaaccgtcaggctgacctgctggggctgtatactccgtacttggacgag
gaggaggcggtggagcgtcgcctgccggctgacatgcctagtgagatcatgggacatcgc
atactggtcgtctgtcatcagttgaagctggaattggacgtggaaccactctttgcatca
atggccctttacgacgccaaagaaaagaaaaaaatctcagaaaacttctactttaacctg
aactccgagtgcacgagacagatgctggcctcccacgtccctcacgcggacctctcgacc
ctcagccggagtgccgtcttcgatatcctcaacccttcgccagatatcttcctggtggtg
agagtggagaaagtcttgcagggcgatgtcaatgagtgcgttgagccttatattaaggat
gataagaaccgcgaaaaagtccgttccggtgctgcagccgcatgcgcccggctcggcaag
taccgcatgccgctcgcctggagtgctgtctccctgctcaacatcctcagcggctccaac
agcctcgagagagaccaggataaggacagcctcaataactgtcctaacactaacagcttg
gaccgcaaagcctcgtcaagcagcttagagcagctccgtcgccgtgcgggcgaggtgggc
ggctcgctgacgcgcaagggctccatcgagcgccgcgcgcccgcgcaccacgccgacgac
ctcgccgccatgctcgacaccttcaagcccatcgtcatcactgtcactagcttcttcaag
cagattgaggtgtctccttgtcctgaggaattgaagaacggactcactcctgagctggct
aagttgcatccttatggagatgacaacgtacgtccatgcaaagagatattatcgttcccg
acgcatgcgccggcgatgcctcactatcagtaccggaacttactctacttgtctgtgaaa
gagatcaatctgaacgcctacacttcaagagctggctccgctaggaatattactgtgcga
atacaactgatgtcgggcgagaatgaggaatcagctctgccggctatatttggcaggagc
tcctgtcccgagttcaccaacgaggcctacaccactgtactctatcataacaagaaccca
tctctctacgatgagataaagctgaagctgccagcagacttaggagaccagcatcacttg
ctgttcacgttcctgcacgtgtcctgtcagaggaaacccgaggggaacatcccgccgcgc
atcggcctcgccaacatggagtctgagctgcgggctagcataaccgaactgccaacagcc
aacgtggaagtcctggcccgctacttaccagtagtgctggacaagctgctgcacctgctg
gtggcccccccggccctggcggggcagacgctgaacatcgcgcaggacgtcttcacctgc
ctcgcgcatctcttcactgatatctctaacatgaacgagggagccacctgcgacaaccac
gggcgcagcagcctgatcagcacgtacatacagtaccagtgcaccatccccagaccctcg
ctcaccgaccgggacatcggactgccgctgccgcctgctgatattgaagtagaggtagcg
aactactcgtatatattccctgatgtcttactgccggggacgcggtggatagacaaccac
aagcccatcttcagcatcactttagatgcacatactactgtgcatccactgctgatggtg
aagtcgatggtggagtacctgtactggagcggagcgcacgaggcgcggcgcaaggctcgc
ttccccgaccagttcaccgacgacgtcaccacgctcgtcaacaatgtcaccacggagatt
atatctagatacggcaaagacagtcgtctaacccagagcctgaacaacagcctagccttc
ttcctgttcgagctgctgagcgtgatggaccgcggctatgtgttcacgctcatccgcacc
tactacaagcacatgtgcgccaagatcgcctctctgccggatgctgtgccgctggtgcac
tataagctagcgttcctccgcatcatctgctctcacgagcactacgtgcccctcaacctc
ccctcctcgggcgggtccccgggcggcgtgtccccggccgcgtcgtgggcctcgctgggc
tcgcagtcctccgccccgccgagacatgccttgcaccatgagtttaggtcaagacattat
ctggctgggttgctgctgactgaactcactaatgctttggatttgcaatgcactcagttc
tacactgaatttcaaaatcacatctacttctcttcacttcaacatggacctttacacncg
ctcaccgaccgggacatcggactgccgctgccgcctgctgtgatgacggatgggtcttgt
aagatcttacacgaggaactggcattgcaatgggtagtggctagtggagccaccagagat
ctcgctatgcagaactcctgggccctcttcgagctgatggtgaagtcgatggtggagtac
ctgtactggagcggagcgcacgaggcgcggcgcaaggctcgcttccccgacca

DBGET integrated database retrieval system