KEGG   Helicoverpa armigera (cotton bollworm): 110381123Help
Entry
110381123         CDS       T05609                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:haw01009]
    110381123
Enzymes [BR:haw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     110381123
Protein phosphatases and associated proteins [BR:haw01009]
 HAD phosphatases
  Other HAD phosphatases
   110381123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6 Hydrolase_like Acid_phosphat_B SRI
Motif
Other DBs
NCBI-GeneID: 110381123
NCBI-ProteinID: XP_021197007
Position
Unknown
AA seq 288 aa AA seqDB search
MQLKGFTSDSNQILTSKILTDRQGNAKIFSARSLGTKSRAFFPSQVQSGRASSRARHFKK
VTHCVFDLDGTVIDSESQYHKILKEICANHGKKYTKELQIRNTGSTDKEVCANVVRELRM
NITADQLQRELQDASRSKLPHAPLQKGAERLLQHLYEKGIKFALATNSSRRAVRLHMAAK
PQIFKLFNHMVCATDPDVDRGKPFPDIYLMAAAKFPDNPKPIKCLVFEDSLVGLEAGLAA
GMQVVLTPPSRLPPQVARRATLVLKSLQDFKPEYFGLPPFSDDSKKLA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaaagggtttacttcggacagtaaccaaattttaacttcaaaaattctaacg
gataggcagggcaatgctaaaattttttcggctcggtcgttgggaaccaaatcgagggcg
ttttttccgtcgcaagtccaatcaggaagggcgtcttcgagagcaaggcatttcaaaaaa
gtgacccattgcgtctttgatttagatggtaccgtgatagattccgaatcacaataccac
aaaatactcaaagaaatatgcgcgaatcacggcaagaaatatacaaaagagctacaaatt
cgcaacaccggctcgactgacaaggaggtgtgcgcgaatgtggtgagggagttgcgtatg
aacatcactgctgatcaactgcaacgtgaacttcaagatgcgagccgatctaaactacca
catgcgccgttacagaaaggagctgaacggcttctacagcacctgtacgagaaggggatc
aagttcgcgctggccaccaactcctcgcggagagcagtcagactccacatggctgcgaag
cctcaaatattcaaactgttcaatcatatggtgtgtgcgactgacccggacgtcgatcgt
ggaaagccgttccctgatatctacctgatggcggctgccaagttcccggataacccgaag
cctatcaagtgcctcgtgttcgaagattcgttagttggcttagaagctggactggcggca
ggaatgcaggtcgttctgacacccccatcacgcttgccacctcaggtcgctcgaagagca
acactagtactcaaatcccttcaggatttcaagccggaatactttggtttaccgcctttt
tctgacgacagcaaaaaactagcttag

DBGET integrated database retrieval system