KEGG   Helicoverpa armigera (cotton bollworm): 110381269Help
Entry
110381269         CDS       T05609                                 

Definition
(RefSeq) uncharacterized protein LOC110381269
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00250  Alanine, aspartate and glutamate metabolism
haw00650  Butanoate metabolism
haw01100  Metabolic pathways
Module
haw_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    110381269
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110381269
Enzymes [BR:haw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     110381269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 110381269
NCBI-ProteinID: XP_021197233
Position
Unknown
AA seq 505 aa AA seqDB search
MDFLRAGVRRHTFARIQYRQLHLLQNKAYVEGKWISAGSGNVFKVENPADDSLIAKVPDM
GAADAKKAIDAAAEAFKSWKNTTPKERSNILRCWYEIVEANSKDLAAIVTAESGKPLSES
YGELAYGNSFLDWFADCARHVKGEMILSPWPNKQIMVTRQPVGVVSVITPWNFPFAMITR
KVGALLAAGCTCVVKPSEDTPLTALAAIQLAEQAGVPKGVINVITSSRKNVAEVGKVLCE
DPHVRLISFTGSTVVGKVLSAHAAKGVKRVGLELGGNAPFIVFPSADIARALDHAMLAKF
RNNGQACVGANRFLIHEDVYDQFVNGFKEHIQKKCKLGPGTHEGVTCGPLINLEQAKKVS
SFVEDAVNKGARTLVGGRFATDLGNKFFESTLIDNVKPGMKVYHDEVFGPVASVIKVKSE
EEALEIANSTKHGLAAYVFTKDLGQAFRMSRDLEFGMVAINDGILSTAEAPFGGIKESGI
GREGSMHGVEEYTEIKYTLMSGLEK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttacgtgccggtgttcgaagacatacttttgcaagaattcagtataggcaa
ttgcatttgttacaaaataaagcatatgttgaaggcaaatggataagtgcgggaagtgga
aacgtgttcaaagtggaaaaccccgctgacgacagccttattgcaaaggtgcctgatatg
ggagccgctgatgctaaaaaagctattgacgcggcggctgaggcctttaagtcttggaaa
aataccacgcccaaggaacgttccaatattttgaggtgctggtatgaaattgtggaagcc
aattccaaagatctagcagccatagtgactgctgagtctggaaaaccactgtctgaatct
tacggtgaacttgcctatggtaactctttcttggactggtttgcagattgtgcacgtcat
gtcaaaggagaaatgatattgagcccttggcccaacaaacaaataatggttacacgacag
ccggttggtgtagtatcagttattactccatggaactttccttttgctatgataacaaga
aaagtaggtgccctgttggctgcaggctgcacatgtgtcgtcaaaccttctgaagataca
cctctaacagcccttgctgctattcaattggcagaacaagctggtgtgcctaagggagta
attaatgttattacaagtagcagaaaaaatgttgcagaagttggcaaagtcttgtgtgaa
gaccctcatgtgagattaatctcttttacgggttccactgttgttggtaaagtattgtct
gcacatgctgcaaaaggagtcaaaagggtgggtctcgaattagggggaaatgcaccattt
attgtttttcctagtgctgacatagcgcgagcattagatcatgctatgcttgcaaaattc
aggaataatggacaggcatgtgttggagcgaataggttccttatacatgaagatgtttat
gaccaatttgtcaatggttttaaggaacatatacagaaaaaatgtaaactaggaccaggc
acacatgagggagtcacatgtggcccacttattaatttggagcaagcaaagaaggtttct
agctttgtagaagatgctgtaaataaaggtgcaagaacattggttggtggcagatttgct
acagaccttggaaacaagttctttgagtccacattaatagataatgttaaacctggtatg
aaggtatatcatgatgaagtatttggccctgttgcatcagttataaaagttaaaagcgaa
gaagaagctttagaaattgctaacagtaccaagcatggtttagctgcatatgttttcacc
aaagacctaggccaagctttcagaatgtccagagatcttgaatttggaatggtcgccatc
aatgatggtatattatccactgcagaagctccatttggaggcattaaggagtctggtatt
ggtagagaaggtagtatgcatggcgttgaagagtacactgaaatcaaatataccctgatg
tcaggactggaaaagtaa

DBGET integrated database retrieval system