KEGG   Helicoverpa armigera (cotton bollworm): 110382443Help
Entry
110382443         CDS       T05609                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00600  Sphingolipid metabolism
haw01100  Metabolic pathways
Module
haw_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110382443
Enzymes [BR:haw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     110382443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 110382443
NCBI-ProteinID: XP_021198722
Position
Unknown
AA seq 607 aa AA seqDB search
MADLKNGKDVSNVGEGDSLSKDVVYLEETFYILSKKNSVFRVRLTPKGLSLTKETDGNCK
EQTILLADIIGSKCMRSKRRRPGAGSCVCSSFVGNNQLKVVDENSGDLDENDISAYLYIY
AYILKRSRRTLKRERTTITLRFRSFDKYEDNNKEAQKWRTTIKCLIACQPITSTPPTNDK
KLLVLLNPKSGPGKARELFQAKVAPILQEAEVPFELHVTKYAQYAREFVRTRNVYGWRAI
LAIGGDGVLFEIMNGMFERLDWQQALAEVPLAILPCGSGNGLARTICHLYNEPYIPQNLT
GLTMAIVKGHSAPMDVVRIETKTSIMFSFLSVGWGLLSDIDIESERLRAIGGQRFAVWAL
ARLVGLRTYKGVVSYAKIKDVSNLPKPKQPLTLSHSISQDGALDSPDAEAFIDADEHSEV
FVNAINGKQHQRVDSWYSVNSRRSAFYSTRGSEYHSVTSSGSEMRSPVHACMHGPASHLP
SLMSQLPSHWVHEHGEFVMVHVSYQPYIGEDFLFAPRSQLSDGIMWMLIIKAGISRSQLL
SFLMGVGQGTHADMNNDYVKMVPVSAFRIVPEGTTGNLTVDGEVVEYGPIQAEIFPNIIN
LLVPEMK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctaaagaacgggaaggacgtatcaaacgtcggtgagggtgactctctttcg
aaagatgttgtttatcttgaagaaacattctacattctttccaagaagaattcagtattt
cgtgttcgactcactcctaaaggtttatctctaacaaaagaaacagatggcaattgcaaa
gaacaaacgattcttttggccgatatcataggcagcaaatgcatgaggagcaaaagacga
cgccctggagccggttcctgcgtctgtagttccttcgtgggcaacaatcagctcaaagta
gtggacgagaacagtggtgatctcgacgagaacgatatcagtgcgtatttgtacatttat
gcttacatattgaaacgcagccgccgtaccttaaaaagggagagaacaacaataacactg
cgcttcagatctttcgataagtatgaagataataataaagaagctcagaaatggagaacc
acaataaagtgtttgatagcctgtcagccgattacgtccacgccgccgaccaacgataag
aagttgttggtacttttaaatccgaagtcggggccggggaaggctagagagttgtttcag
gctaaggtggcgcctattttgcaagaagcggaggttcctttcgagcttcacgtgacgaag
tatgctcaatacgcgcgggagtttgtgcgtacgcgaaatgtgtatggttggcgcgcaata
ttggctatcggcggtgatggcgtgctgttcgagataatgaacggcatgttcgagcggctc
gactggcagcaggccctggcggaggtgccactcgccatattaccctgtggatctggcaat
ggccttgcaaggactatttgtcatctgtacaatgagccgtacattcctcaaaacttaact
ggtttaacgatggcgatagtgaagggccactcggcaccaatggacgtagttcgcattgaa
acaaaaaccagcattatgttttcgtttctttcggttggatggggcctcctatctgacatt
gatatcgaaagcgaaagattacgagcaatcggaggccaaaggttcgctgtttgggcactt
gcaagactagtgggactgaggacatataaaggtgtagtgagttacgcgaaaattaaggat
gtgagcaatcttcctaaaccaaaacaaccgctcaccctcagtcatagcatcagtcaggac
ggagcgctcgactcccctgatgcggaagcgttcattgacgcggacgaacattctgaagtg
ttcgtgaacgctattaacgggaaacaacatcaaagggtggactcatggtattctgtcaac
tcacggaggagcgcattttacagtacacgtgggtcagagtaccacagcgtgacgagtagc
ggctctgaaatgcggtcacccgtgcacgcgtgcatgcacggacctgcttcccacctgccc
tcgctcatgtcccagttgccgtcgcactgggtacacgaacatggtgaattcgtcatggtt
cacgtttcctaccaaccttacattggagaagactttctatttgctccacggtcacaacta
tccgatggaatcatgtggatgttgatcataaaagcaggaatatccagatctcaattactg
tcgttcctcatgggtgtcggccaaggtacgcatgccgatatgaataatgactacgtaaaa
atggttcctgtgagtgcgtttagaatagtgccagaggggaccaccggtaacctcacggtg
gacggcgaggtcgtcgaatacggacctatacaggctgaaatattcccgaacattattaat
ttattagtgccagaaatgaaataa

DBGET integrated database retrieval system