KEGG   Helicoverpa armigera (cotton bollworm): 110382618Help
Entry
110382618         CDS       T05609                                 

Definition
(RefSeq) inactive peptidyl-prolyl cis-trans isomerase shutdown-like
  KO
K09572  FK506-binding protein 6 [EC:5.2.1.8]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Brite
KEGG Orthology (KO) [BR:haw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:haw03110]
    110382618
Enzymes [BR:haw01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110382618
Chaperones and folding catalysts [BR:haw03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    110382618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_11 TPR_7 TPR_8 TPR_12 FKBP_C TPR_14 TPR_19 TPR_6 ANAPC3 MIT SPO22 Mistic Glyco_transf_8C DUF2753
Motif
Other DBs
NCBI-GeneID: 110382618
NCBI-ProteinID: XP_021198950
Position
Unknown
AA seq 461 aa AA seqDB search
MEGMEDMYKDPVQLAEGINMRNLMENKLVEFSIDLDFKTKSMLSTSLDEDLFADIYDDSD
SDDALVKIEESAEKMLLSSPEYHSFDQLSKKMIDCLPSGDVKLLIIEEGDGPLVPPDAEI
LIHHAAYYERCDIPFDTTLTMNKGQPMRIRLGVGKMLPGLEIGITHVKGPKARFHLLLQP
AVAWGRRGILPRIQPKPVLFVITLYDVRCVAAASRFNDLPTAEQAKFETTVKTIKDLRAE
AKDLFKRHKYVQAIRSYQQAMSVLSLSQPQNKSEEEEIKDLKVKMYVNLAICYYKVNKPK
YIIGMCEHIDRIIDINKHCKAIFYYGRAHELLGRIDEAISCYKKALKLEPKNKEIGQILA
DLDQKNKQSAITEKVMWRKALCNEVEKEKLVYDVDGDFKDGVEDMCQELVGRNGYFKFDL
PMGLTKDEVICIKDLTSKFDCLKVLEDGDGKKKKVSIIKKE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatggaagatatgtacaaagatcccgtacagttagcggaagggattaatatg
agaaaccttatggaaaacaaattggtggaattttccatagatttagattttaagacgaaa
tcaatgctatctacttcccttgacgaggatctatttgctgatatttatgatgatagtgac
tcggatgatgctctagtaaaaattgaggagtcagctgagaaaatgttactgtcgtctcca
gagtatcactcgtttgatcagctttcgaaaaagatgatagactgcctgccaagtggtgat
gtcaaactgttgattattgaagaaggagacggccccctagtgcctcctgatgcagaaata
ttaatacaccacgcggcgtattacgagagatgtgatataccgtttgatacaactttgaca
atgaataaaggacagcctatgcgtatccgcctaggcgtaggcaagatgttgccaggccta
gaaataggtataacccacgtaaaaggccctaaggctagattccacctgcttctccaacca
gctgtggcttggggccgtagaggcatactgccgaggattcagcccaagcctgtgttgttt
gtcataactctatatgatgttcgctgtgtcgctgccgcttctaggttcaacgacctccca
acagctgagcaagcaaaattcgaaactacagtgaaaactatcaaagatttacgcgccgaa
gccaaagatttattcaaaagacataaatatgttcaagctataagaagctaccaacaagct
atgtccgtcctatctctctcacaaccacaaaacaaaagcgaagaagaagaaataaaagat
ttaaaagtcaaaatgtatgtcaatttagctatatgttactataaagtaaataaacctaaa
tatattatcggcatgtgtgaacatattgataggattattgatatcaataaacactgtaaa
gctatattttattacggtcgtgcacacgaacttttaggtaggatagatgaagcaatttct
tgttataaaaaagcgctaaagttagaacctaaaaataaagagattggtcagattttagcg
gatttagatcagaaaaataaacagtcagccattactgaaaaggttatgtggcgtaaggct
ttatgtaatgaggttgaaaaagaaaagttagtctatgatgtcgatggagattttaaagat
ggcgtcgaagacatgtgtcaagaattggtgggaaggaatggctatttcaaattcgatctg
ccaatgggtttgacaaaagatgaagtaatttgtattaaagatttaaccagtaagtttgat
tgtttaaaggttctagaagatggggatgggaagaaaaagaaagtttctattattaaaaag
gaatga

DBGET integrated database retrieval system